KEGG   Francisella tularensis subsp. tularensis TIGB03: FTU_0554Help
Entry
FTU_0554          CDS       T01762                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ftg  Francisella tularensis subsp. tularensis TIGB03
Pathway
ftg00020  Citrate cycle (TCA cycle)
ftg00640  Propanoate metabolism
ftg00660  C5-Branched dibasic acid metabolism
ftg01100  Metabolic pathways
ftg01110  Biosynthesis of secondary metabolites
ftg01120  Microbial metabolism in diverse environments
ftg01130  Biosynthesis of antibiotics
ftg01200  Carbon metabolism
Module
ftg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ftg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ftg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FTU_0554 (sucC)
   00640 Propanoate metabolism
    FTU_0554 (sucC)
   00660 C5-Branched dibasic acid metabolism
    FTU_0554 (sucC)
Enzymes [BR:ftg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     FTU_0554 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFB78657
Position
complement(599291..600454)
Genome map
AA seq 387 aa AA seqDB search
MNLHEYQAKDLLESYGLKVQKGIVAHNPNEAAQAFDQLGGKFAVVKAQVHAGGRGKAGGV
KVVKSSQEAREVAESLIGKNLVTFQTDAEGQPVNSVGVFEDVYPVTRELYLGAVVDRSSR
KVTFMASTEGGVDIEEVAHNSPEKILKVEVDPLVGLQPFQAREVAFKLGLEGKQINDFVK
TMLGAYKAFIECDFALFEINPLAVRENGEIVCVDGKINLDSNALYRHPKLLALRDKSQEN
AKELKASEHELNYVALEGNIGCMVNGAGLAMATMDIIQLYGGKPANFLDVGGGATKERVI
EAFKLILDDENVKAILINIFGGIVRCDMIAEAIIEAVKEVNVTVPVVVRLEGNNAEKGAK
ILADSGLKLIPADGLADAADKVVKSLG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaagctaaagatcttttagaaagctatggtctaaaagttcaa
aaaggtatcgtagctcataacccaaatgaagctgctcaagcatttgaccaattaggtggc
aaatttgctgtggttaaagctcaggtacatgctggtggtcgtggtaaagctggtggtgta
aaggttgttaaatcatctcaagaagctcgtgaagtagcagaaagcttaatcggtaaaaat
cttgttactttccaaactgatgctgaaggtcagccagttaattctgtaggtgtatttgaa
gatgtataccctgttactcgtgagttataccttggtgcggtagttgatagatctagccgt
aaagtaacattcatggcttcaactgaaggcggtgtagatattgaagaagttgcacacaac
tctcctgaaaaaatccttaaagtagaagtagatcctttagttggcttacaacctttccaa
gctcgtgaagtagctttcaagcttggtctagaaggcaagcaaatcaatgattttgttaaa
actatgctaggcgcttacaaagcattcatcgaatgtgattttgccctatttgaaatcaac
cctcttgcagttagagaaaacggagagattgtctgtgttgatggtaaaatcaaccttgat
tcaaatgctctttatagacaccctaaacttttagctctaagagacaaatctcaagaaaat
gctaaagaacttaaagcttcagagcatgagctaaactatgtagctcttgaaggtaacatc
ggttgtatggtaaacggtgctggtctagcaatggctactatggatattatccaattatac
ggtggtaagcctgctaacttcctagatgtaggtggtggtgctactaaagagagagtaatc
gaagctttcaaactaatcctagatgatgaaaatgtaaaagctattttaattaacatcttc
ggtggtattgttcgttgtgatatgatcgctgaagcaattattgaagctgttaaagaagta
aatgtaactgtaccagtagttgttcgtctagaaggtaacaatgcagaaaaaggtgctaaa
atattagctgattcaggtttaaaactaatacctgctgatggtttagctgatgctgctgat
aaagttgtgaaatcactaggttaa

DBGET integrated database retrieval system