KEGG   Francisella tularensis subsp. tularensis TIGB03: FTU_0799Help
Entry
FTU_0799          CDS       T01762                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ftg  Francisella tularensis subsp. tularensis TIGB03
Pathway
ftg00040  Pentose and glucuronate interconversions
ftg00052  Galactose metabolism
ftg00500  Starch and sucrose metabolism
ftg00520  Amino sugar and nucleotide sugar metabolism
ftg01100  Metabolic pathways
ftg01130  Biosynthesis of antibiotics
Module
ftg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ftg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FTU_0799 (galU)
   00052 Galactose metabolism
    FTU_0799 (galU)
   00500 Starch and sucrose metabolism
    FTU_0799 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    FTU_0799 (galU)
Enzymes [BR:ftg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     FTU_0799 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AFB78875
Position
852774..853637
Genome map
AA seq 287 aa AA seqDB search
MKIRKAVFPVAGWGTRFLPATKSCPKEMLTVVDKPLIQYAVEEAIEAGCKEIIFVTSSNK
KSLEDHFDRNFELEYSLEKKQKYELLDLVKNIIPKDVSFFFVRQPEALGLGHAVLCAKPL
VGIEDFAVILPDDLIYNHDCGTGTLKQMVKAVEGTDIRGCIATQQVKREKTNSYGIVAKD
NDNLIKAIVEKPAPEKAPSTNAVVGRYLLPNKIFRCLESTSEGAGGEIQLTDAIAKLLDQ
DEKILSYEFKGTRYDCGSKLGFLIANYEIALQHQELGHKFKEYLQNR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagaaaagcagtttttcctgtagctggatggggcactagatttttaccagct
actaaatcatgtcctaaagaaatgctaacagttgttgataaaccattgatccaatatgct
gttgaagaggctatagaggcaggctgtaaagagataatatttgttactagctcaaataaa
aaatccctagaagatcattttgatagaaactttgaattagaatattcgctagaaaaaaaa
caaaaatatgaattgttagatttagtaaaaaatataattcctaaagatgtaagttttttc
tttgtacgtcagccagaggcgctaggactagggcatgcggttttatgtgcaaaaccacta
gttggaattgaggattttgcagttatattacctgatgatttaatttacaatcatgattgt
ggtactggtacgctaaagcaaatggttaaggcggtagaaggtactgatattagaggttgt
atcgcaactcaacaagtcaagagagaaaaaacaaattcatatggtatagttgcaaaagat
aatgataatctaatcaaagcaattgttgaaaagccagcaccagaaaaagcaccatcaact
aatgcagttgtgggtagatatttattaccaaataagatttttagatgtttagaatcaact
tcagagggcgcaggtggtgagattcaactaactgatgctatcgctaaattattagatcag
gatgagaaaattttgtcttatgaatttaagggtactcgttatgattgtggcagtaaatta
ggttttttaattgctaattatgagatagctttacagcatcaagagttaggacataaattc
aaagaataccttcaaaatagatag

DBGET integrated database retrieval system