KEGG   Francisella tularensis subsp. tularensis TIGB03: FTU_0966Help
Entry
FTU_0966          CDS       T01762                                 

Definition
(GenBank) Beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ftg  Francisella tularensis subsp. tularensis TIGB03
Pathway
ftg00520  Amino sugar and nucleotide sugar metabolism
ftg01100  Metabolic pathways
ftg01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ftg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FTU_0966
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    FTU_0966
Enzymes [BR:ftg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     FTU_0966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 TPP_enzyme_M CheF-arch
Motif
Other DBs
NCBI-ProteinID: AFB79023
Position
complement(1015249..1016916)
Genome map
AA seq 555 aa AA seqDB search
MSTNSNIRQKLGQLIMMDFRYWGEDSNNQRIPFTKTNDIVNKIFKDYNLGGFILFRENIQ
NNEQVISLLRDLQANTNTPIFFATDQEGGRVNRLQQGISGCGNMALAATDNPHNAYTMAK
IIGDELYSLGININFAPAVDVNSNKNNPIIGVRSYSDNPDIVIDYAKNAINGYHDAKIID
CIKHFPGHGDTATDSHLGNVNLDKTLKELQTTELLPFSKLARDCSMIMTAHISVPALDDT
QYQSVSTSENIYVPATLSYKIITKLLKQQMKFDGLVVSDAMDMHAIAKHFGTIEASKLAI
LAGIDILLMPVRVWSENDLYKLEELFCELEKGYNQNSNFANAVDNVYTNITDFKAKHKLD
ESLIFKLSQDEQLKYANQIVNSNKHQQIALDIAKQSTTVVKNSGIIPCDLNKLKNILIVD
SDNQRLADFHSELQKIVLDNNSNVIINCENINNHNIKTIIENADLILLISANLREYNQTY
SYITSIKPEQTINIAALTPYDINYIDNIINYVCIYGATSMDYTNYTKTSLKINIQTTLEN
IFGNKEIKGVLPVSL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaaactcaaatataagacaaaaactaggtcaactaattatgatggattttcgc
tattggggtgaagattcaaataatcagcgtataccttttacaaaaactaatgatatcgtc
aataagatctttaaagactataatttaggtggttttatcctttttagagagaatattcaa
aataatgagcaagttatctctctattaagagatcttcaagctaacaccaatacaccaata
tttttcgctacagatcaagaaggtggcagagttaatcgcttacaacaaggtattagtggt
tgcggtaatatggcactagctgcaacagataatcctcataatgcctatactatggctaaa
ataattggcgatgaattatattctttaggtatcaatattaattttgctccagctgtggat
gttaactctaacaaaaataatcctattattggtgtaagatcatactcagataatcctgat
atagttattgactacgccaaaaatgctataaatggttatcatgatgcaaaaattatagac
tgcattaaacatttccctggtcatggtgatactgcaacagatagtcatttaggcaatgta
aacttagataaaactttgaaagaattacagacaacagagctactaccctttagtaaactt
gctagagattgtagtatgataatgacagcacatattagtgtaccagccctagatgacacc
cagtatcaatcagtttcaacaagtgagaatatttatgtgccagccaccctctcttataaa
ataataactaaattactaaaacaacaaatgaaatttgatggtttagtagtatctgatgcc
atggacatgcatgctattgctaaacactttggaactattgaggcttctaaattagctatc
ttagctggtatagatattttattaatgcctgttcgagtatggtcagaaaatgatctttat
aaattagaagagcttttttgtgaactagaaaaaggatataatcaaaattctaattttgct
aatgcagttgataatgtctatacgaatattactgatttcaaagcaaaacataaactcgat
gaaagtttaatattcaagctctcacaagatgagcaattaaaatatgctaatcaaatagtt
aactctaataaacatcaacaaatagctttagatattgctaaacaaagtacaactgtagtt
aaaaattcaggtattattccatgcgatctcaataagctaaaaaatatcttgattgtagat
agtgataaccaacgcttagcggattttcatagcgagttgcagaaaatagtattagacaat
aactcaaatgttattattaactgcgaaaatattaataaccataatattaaaactattatc
gaaaatgccgatctgatcctattaatttcagcgaatcttcgtgaatataatcagacctat
agttatataacttctataaagccagagcaaactataaatatagcagcacttactccttat
gatattaattatatagataatattattaattatgtttgtatttatggtgcaacttctatg
gattatacaaactatacaaagacttcactaaagattaatattcaaacaacattagaaaat
atttttggtaataaagagattaaaggagtactaccagtcagtttataa

DBGET integrated database retrieval system