KEGG   Francisella tularensis subsp. tularensis TIGB03: FTU_1317Help
Entry
FTU_1317          CDS       T01762                                 

Gene name
metG
Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ftg  Francisella tularensis subsp. tularensis TIGB03
Pathway
ftg00450  Selenocompound metabolism
ftg00970  Aminoacyl-tRNA biosynthesis
ftg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    FTU_1317 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FTU_1317 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ftg01007]
    FTU_1317 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ftg03016]
    FTU_1317 (metG)
Enzymes [BR:ftg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     FTU_1317 (metG)
Amino acid related enzymes [BR:ftg01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   FTU_1317 (metG)
Transfer RNA biogenesis [BR:ftg03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    FTU_1317 (metG)
 Prokaryotic type
   Other AARSs
    FTU_1317 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1 Adenyl_transf
Motif
Other DBs
NCBI-ProteinID: AFB79337
Position
1389940..1391799
Genome map
AA seq 619 aa AA seqDB search
MLKAKSLGITPEELVTKYSNRHLQDFTDFEINFDNYHSTHNSLNKEIVEDIYNKLNNKNL
ISKKAIAQAYDPEAKMFLPDRFVKGTCPKCKAEDQYGDSCEVCGATYDPTELINPRSVIS
GQSPIQKNSEHFFFDLPALEKNIKDWIESNTLLQPEVANKLAEWFEQGLQSWDISRDAPY
FGFAIPGTNEQKFFYVWLDAPMGYIASFKDYCNKNNINFGDFWGDSSSESELYHFIGKDI
IYFHTLFWPAILSSTGYKTPTSVFANGFLTVNGKKMSKSRGTFIQARTYLDNLEPSYLRY
YFASRLTSRIDDIDLNLEEFVTKSNSDIVGKVVNIASRCAGFIYKKFDATLSGEIFDPEL
ESEFSKNHDAITQAFEKREFAHAVRLIMALADKANQFIDYHKPWQLAKEEGQEQKVHQVC
SQGINMFKVLIVYLKPIIPSIVAEAERFLNIQFISWADAPKFLINHKIDKFKPLATRIEK
EKVDKILEDTKKMLENEQSPQSKKEEPKLDIAAECTFDDFMKVDLRIAKITEASHVEGAD
KLLKLILDLGGVTKQVFAGIKSAYKPEDLIGKHTIMVANLAPRKMKFGMSEGMVLAAGDG
KGIYILEPHEGAQPGMRVK
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagccaagagtcttggaattactccagaagagttagttacaaaatactctaat
agacacttacaagattttactgattttgaaattaattttgacaattatcactctactcat
aattctctaaataaagagattgttgaagatatatataataaacttaacaataaaaatctt
atttcaaaaaaagcaatagctcaagcttatgaccctgaggctaaaatgtttttgccagat
agatttgtcaagggaacttgtccaaaatgtaaagctgaagatcagtatggtgatagctgt
gaagtttgtggtgccacatatgatcctacagagcttatcaatccaagatctgtaatatct
ggtcaatcgccaatacaaaaaaactctgaacatttcttttttgacttacccgcattagaa
aaaaatataaaagattggatagaatctaatacactcttacaaccagaagttgctaacaaa
ctagcagaatggtttgagcaaggcttacaaagttgggatatctcgcgtgatgcgccatat
tttggctttgcaatcccaggtacaaatgaacaaaaattcttctatgtgtggctagatgct
ccaatgggctatattgcaagcttcaaagattattgtaataagaataatattaattttggt
gatttctggggagatagttctagtgaaagtgagctttatcattttattggtaaagatatt
atttattttcatacactattttggccagcaatattatcatctactggttataagacacct
actagtgtatttgctaatggtttcttaactgtaaatggtaagaagatgtcaaaatctcga
gggacgttcattcaagctagaacttacctagataatttagagcctagttatttaagatac
tactttgcgtcaagattgacatcccgcattgatgatatagatttgaatctagaggaattt
gttactaaatcaaattctgatatagtaggtaaggtagtcaatattgccagtcgttgtgct
ggatttatatacaaaaaatttgatgctaccttgtctggagagatttttgatccagaatta
gaaagtgaatttagtaaaaaccacgatgctataacacaagcttttgagaaaagagagttt
gcccacgctgtgagactgataatggcattagccgataaagctaatcaatttatagattac
cataaaccttggcaactagctaaagaagaaggacaagaacaaaaagttcatcaagtctgt
tcacaaggtataaatatgtttaaggttttaatcgtttatcttaagcctattattcctagc
attgttgctgaggcagagagatttttaaatatacagttcataagctgggctgatgctcca
aagtttttaataaatcataaaatagataaattcaaacctctagccactcgtatcgaaaaa
gaaaaagtagacaaaattttagaggatacaaagaaaatgttagaaaatgaacaatctccg
caatctaaaaaagaagagcctaaactagatatcgcagctgaatgtacttttgatgatttt
atgaaagtagatttgcgtatagctaaaattactgaagcttcacatgttgaaggtgcggat
aaattacttaaactaatattggatctaggtggtgtcaccaaacaagtttttgctggtatc
aagtctgcttacaaacctgaagatttaattggcaagcatactataatggtagcaaatcta
gctcctagaaaaatgaaatttggaatgtctgagggcatggttttagctgctggagatggt
aaaggtatatatatacttgagccacatgagggtgcccaaccaggtatgcgtgtcaaataa

DBGET integrated database retrieval system