KEGG   Francisella tularensis subsp. tularensis TIGB03: FTU_1369Help
Entry
FTU_1369          CDS       T01762                                 

Definition
(GenBank) hypothetical protein
Organism
ftg  Francisella tularensis subsp. tularensis TIGB03
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFB79389
Structure
PDB: 

Position
1455675..1458137
Genome map
AA seq 820 aa AA seqDB search
MIAVKDITDLNIQDIISQLTSEVINGDTTSSSAKFACEINSYIINYKLLNINLINTQLKN
TKILYRKGLISKLDYEKYKRYCVICRLKNNIDEFILYFSTNYKDSQSLKIAIKELQNSCS
SSLILELPHDYIRKIDVLLTSIDSAIQRSSDLNKTIIKQLNKLKSSLSRYIGYNNVLQKQ
EITINIKPINKNFELEDISFVSTRNKQYFKHNSLTLKNPHIEKLEVCENIYGINGWLTFD
LAYINNHKDFNFLLSPNQPILLDIQINDSFNFYKKESKKDHHKRTTRFMAIGFNSNSIDI
HENFEYSIYSYTKNVSSGVKKFKIQFHDPLKALWTKHKPSYIALNKSLDDIFKENFFFDN
LVSLDTNKSNNLKIRIPQAFISTVNRNFYDFFIQQLEQNKCYLKYFCDKKSGKVSYHVVD
QVDNDLQRNIVNSDEDLKDKLSPYDISCFKKQILISNKSNFYVKEKNICPDVTLNTQKKE
DRKISDTLIKPFSSILKDNLQSVEYIQSNNDDIQEIITTGFEILLTSRNTLPFLDTEITL
SKLDNDQNYLLGATDIKSLYISQRKLLFKRSKYCSKQLYENLHNFHYKSDSESDVYEKIA
FTKYPSLTHDNLITYKIKDYSNLTPEYPKYKSFSNFYINGRVTIGENVNNDSKKAYKFFK
NYKPEESSIAEFQENGEKGTSAILNSKADILYAIEIAKEMLSDKSSDKPIIYLPLKVNIN
SANNQFIPLRNDDIILIEMQSFTKGEIIELISNSAISTKKAQQQLLQRQLLGSKENCEMA
YTQTSDSETFSLTQVNEDCENSFLINDKKGIFLRYKSKGN
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgatagcagtaaaagatataactgatttaaatatacaagacataattagtcagttaact
tctgaagttataaatggcgacacaacctcttcttctgccaagtttgcttgtgaaattaat
agctatattattaattacaaactattaaacattaatcttattaatactcaactaaaaaat
acaaagatactttatagaaaaggcttgatatctaagcttgattacgaaaaatataaaaga
tattgcgtaatatgtagattaaaaaataacatagatgaatttatcttatatttttcgaca
aactataaagactctcaaagcttaaaaatcgcaattaaagaattacaaaactcatgctca
tcaagtttaattcttgagctccctcatgattacataagaaaaattgatgtcttactaact
agtatagatagtgcgatacaaagatcaagtgatctcaacaaaacaattataaaacagtta
aataagcttaaaagcagcctttcacgatatattgggtataataatgtactgcaaaaacaa
gaaattactataaatataaagcctattaataaaaattttgaacttgaggatataagtttt
gtatcaactagaaataagcaatattttaagcataactctcttacacttaaaaaccctcat
attgaaaaattagaagtatgtgaaaatatctacggcataaatggctggttaacttttgat
ttagcatatatcaataatcacaaagactttaacttcctattaagcccaaatcaacccata
ttacttgatattcaaattaatgatagcttcaatttttacaaaaaagaatctaaaaaagat
catcataagagaacaacccgttttatggccattggctttaattcaaacagtatagatatt
catgagaactttgaatacagcatatattcttataccaaaaatgtttcttcaggagtaaaa
aaatttaaaatacaattccatgacccactaaaagcactttggactaagcacaaaccatct
tatatagctttaaataaaagcttagatgatatctttaaagagaattttttctttgataat
ttagtttctttagataccaacaaaagtaataacctaaaaatacgtataccacaagcattt
atttctacagttaatcgaaatttttatgatttttttattcaacaacttgagcaaaataaa
tgctatttaaaatatttctgtgataagaagagtggcaaagtaagctatcatgttgtagat
caagtagataatgacttacaaaggaatatcgtaaattcagatgaagatttaaaagacaaa
ctatctccttatgatataagctgcttcaaaaaacaaattctaatctcaaataaatcaaac
ttttatgttaaagaaaaaaatatatgtcctgatgtgactttaaacactcaaaaaaaggaa
gatcgaaagatttcagataccttaataaagccattctcatccatactcaaggataactta
caatctgtagagtatatacaaagcaataatgatgatatacaagaaattattactacagga
tttgagatattactgacatcaagaaatactctgcccttcttagatactgaaattactctt
tctaaactagacaatgatcaaaactatcttttaggcgcaacagatataaaaagcttatat
ataagtcaaagaaagctattatttaaaagaagtaaatactgctctaaacaactatatgaa
aacttacataattttcactataaaagtgattctgaatcagacgtatatgaaaaaattgct
tttactaaataccctagtctgacacatgacaacttaataacttataaaattaaggattat
agtaatctaactcctgaatatcctaagtacaaaagttttagtaacttttatattaatggt
agagtaacgattggagaaaatgttaataatgactccaaaaaagcttataaattctttaaa
aattataagccagaagaaagctcaatcgcagaatttcaagaaaatggtgaaaaaggtact
tcagctatactaaatagtaaggctgatatcttatacgcaatagaaattgccaaggaaatg
ttatctgataaatcatcagataagccaatcatatacttacctctaaaagtaaacataaat
tctgctaataatcaatttataccattgagaaatgacgatattatcttaattgaaatgcag
tcttttactaaaggtgaaattattgagttaatttcgaactctgccatatcaacaaagaaa
gctcagcagcaactactacaacgacaacttcttggatctaaagaaaactgtgaaatggca
tatacccaaacaagtgatagcgagacattctcactaactcaagtaaatgaagattgtgag
aattcttttttgataaatgataaaaaaggtatttttctaagatataaatcaaaaggaaat
taa

DBGET integrated database retrieval system