KEGG   Francisella tularensis subsp. tularensis TIGB03: FTU_1375
Entry
FTU_1375          CDS       T01762                                 

Definition
(GenBank) hypothetical protein
Organism
ftg  Francisella tularensis subsp. tularensis TIGB03
SSDB
Other DBs
NCBI-ProteinID: AFB79395
Position
1464567..1465997
AA seq 476 aa
MDEKRKDLSTNDASILKKTFDKLSNDIRDDFDKRIFDYSNALLFKYYSNLYYFIPKSCLL
EISDKGHNGYYIPPQEYFFIEDKRTGKTLTYTTKSENIILPIRDITTIKQSDTSINISLE
FANNFDYDYVTIWIDPTLCKEDPSFATYIFNQVLEDNGSAKIKFSNHSYTTKNVQIEPIK
FQLKPTEKLVLNIHSPSLLYGFNIKIKDLFKYKNNDLNKIDFFLEVKTENHNDEKLSSLF
RVNLIPVFNSFDDYSSTSFASMNLSESKLKHHQKDDAQAIEVLSVYENNKQCDFNSFLFV
GQNEYYFNRSTQSLNYSSVLPQFSNKIIGTKIHTYTTWTQITEISDLIEINSNAIASISC
NISPIVINKALNNYNSNAKEMFNIIDMIISKNMYSKTTLLAIAKLLKINTNDLTLLSMLL
QDVEMDSTINELILTLSDKYNPKYKHFLNFHIGIICKFINQNTFSFIKKIVLNNSI
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggatgaaaaaagaaaagatttaagtacgaatgatgctagcatcctaaaaaaaactttt
gacaaactaagtaatgatataagagatgattttgataagagaatttttgattatagtaat
gctcttttattcaagtattatagtaacctttattatttcattcctaaatcatgcttatta
gaaataagtgataaaggacacaatggttactatattccgcctcaggaatattttttcata
gaagacaagagaacaggtaaaactctaacatatacgacaaagtcagaaaatataatactc
cctattagagatatcacaaccataaaacaaagtgatacatcaataaatatatcattggaa
tttgcaaataactttgactatgattatgttactatctggatagatccaactttatgtaaa
gaagatcctagctttgccacatacatatttaaccaagtattagaagataatggctcagca
aagattaaattttcaaatcatagttatacaacaaaaaatgtacaaatagaaccaattaag
ttccaattaaaaccaacagaaaaattagttctcaatatccattctcctagccttttatat
ggttttaacataaagatcaaagacttatttaaatacaaaaataatgacctcaacaaaatt
gacttttttttagaagttaaaactgaaaaccataatgacgaaaaattatcatctctattt
agagttaatttaatacctgtgtttaatagttttgatgattactcaagcacctcatttgct
tcgatgaatctctcagagagtaaactaaaacatcatcaaaaagatgatgctcaagcaata
gaagtattatctgtttatgagaataataaacaatgtgattttaatagttttctttttgta
ggacagaatgagtattattttaatcgcagcacacaatctttaaattatagtagcgtactc
cctcaatttagtaataaaataataggaacaaaaatacatacatatacaacctggacacag
ataactgagatttctgatctaattgaaattaactcaaatgcaatagcatctataagctgt
aatatttctccaatagttattaacaaagcactaaacaactacaatagcaatgctaaagaa
atgtttaatataatagatatgatcatctctaagaatatgtattcaaaaacaacactccta
gctatagcaaagcttttaaagattaatactaatgacttaactttactttcaatgctccta
caagatgttgagatggactctactataaatgagctaattttaaccttaagtgataaatat
aacccaaaatataaacatttcttaaattttcatattggtattatatgcaaatttataaat
caaaacacctttagctttattaaaaagattgttttaaataactctatataa

DBGET integrated database retrieval system