KEGG   Francisella tularensis subsp. tularensis TIGB03: FTU_1380Help
Entry
FTU_1380          CDS       T01762                                 

Definition
(GenBank) hypothetical protein
Organism
ftg  Francisella tularensis subsp. tularensis TIGB03
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFB79400
Position
1472589..1473164
Genome map
AA seq 191 aa AA seqDB search
MSKKIFKLLSISIIFSIYQQTFSNTIIASTFELKNSSKKNATIFLNLNEFCPTNIAACKD
ENDNNCIYITELVREPLSRIYYYLAVPITSKSVKDLTILYKHDKEESPPEAINICLSLFK
NNKHETYYSQVIYNWFVSSELYLSFSEGSIFINKDINNSNNYDKGNFLSVNLERIADGWA
PPHYEKKITII
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaaatatttaaattattatcaatttcaataatatttagtatatatcaacaa
acatttagtaatacaataatagctagtacattcgaactaaaaaatagttctaaaaaaaat
gctactatctttctaaatttgaacgagttctgtccgactaatatagcagcatgcaaagat
gagaatgacaataattgtatttatataactgaattagttagagaacctcttagtcgtatt
tactattacttagccgtgccaattaccagcaaatcagttaaagacttaacaatattatat
aaacatgataaagaagaatctccaccagaagcaataaatatatgtttgagtttatttaaa
aataataagcatgaaacatactattctcaagttatatataattggtttgtatcttcagaa
ttatatttatcatttagtgaaggatctatttttataaataaagatattaataattctaat
aattatgataaaggtaattttctaagcgtaaatctcgaacgtatagctgatggctgggcc
cctcctcattatgaaaagaaaattactataatataa

DBGET integrated database retrieval system