KEGG   Francisella tularensis subsp. tularensis TIGB03: FTU_1383
Entry
FTU_1383          CDS       T01762                                 

Gene name
iglB1
Definition
(GenBank) Uncharacterized protein ImpC
  KO
K11900  type VI secretion system protein ImpC
Organism
ftg  Francisella tularensis subsp. tularensis TIGB03
Brite
KEGG Orthology (KO) [BR:ftg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ftg02044]
    FTU_1383 (iglB1)
Secretion system [BR:ftg02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   FTU_1383 (iglB1)
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AFB79403
Structure
PDB: 
3J9O

Position
complement(1475034..1476554)
AA seq 506 aa
MTINKLSLTDELLNNFGGSTEVDSVLKNIDFDVSDDASKVLSLSTDYNARNLMALSLVLA
NNDNINNYNQKYIQKVITVIDKLIDLQVNSIISNDEFRALEQEWLKVQEVCQEDYDNVEV
SILDVKKEELQYDFERNLYDISSSDFFKKVYVSEFDQYGGEPYGAILGLYNFENTTNDII
WLTGMGMVAKNSHAPFIASIDKSFFGVKDLSEITHIKSFEALLEHPRYKEWNDFRNLDVA
AYIGLTVGDFMLRQPYNPENNPVQYKLMEGFNEFVDYDKNESYLWGPASIHLVKNMMRSY
DKTRWFQYIRGVESGGYVKNLVACVYDNKGILETKSPLNVLFADYMELSLANIGLIPFVS
EKGTSNACFFSVNSAKKVEEFVDGFDSANSRLIANLSYTMCISRISHYIKCVIRDKIGSI
VDVESIQKILSDWISEFVTTVYQPTPLEMARYPFRNVSIEVETIPGKPGWYSCKINVIPH
IQFEGMNTTMTIDTRLEPELFGTNNN
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgacaataaataaattaagtctcactgatgaacttttaaataattttgggggatctaca
gaagttgatagtgtactcaaaaatatagattttgatgtttcagatgatgcttctaaagtt
ttatctttatctactgactacaatgctagaaaccttatggcgctatctttggtattagca
aataatgataatataaataattataatcaaaaatatatccagaaagttattacagttatt
gataagcttattgatttacaagttaattctattatatctaatgatgagtttagagcactt
gagcaagaatggctaaaggtgcaagaggtttgtcaagaagactatgataatgttgaagta
agtatattagatgtaaaaaaagaagagctacaatatgatttcgagagaaatttatatgat
atatctagtagtgactttttcaaaaaagtttacgtttcagaatttgatcaatatggtggc
gaaccttatggcgcaatattaggattgtataattttgaaaataccacaaatgatataatt
tggttgactggaatgggtatggtggcaaagaattctcatgcaccatttattgcatcaatt
gataagtcattctttggtgttaaggatttatcagaaatcactcatataaaaagttttgaa
gctttgcttgagcatcctagatataaagagtggaatgattttagaaaccttgatgttgct
gcatatataggtttgaccgtaggtgattttatgttgcggcaaccatataatcctgagaat
aatccagttcagtataaacttatggaaggctttaatgagtttgttgattatgataagaat
gaaagttatctatggggacctgcttcaattcatctagttaagaatatgatgagatcttat
gataaaactagatggttccaatatataagaggagttgagagtggtggttatgtaaagaac
ttggtagcttgcgtatatgataataaaggcattctagaaactaagtcacctttaaatgta
ttattcgctgattatatggagttatcacttgcaaatattggtttaataccatttgtaagt
gaaaaaggtactagtaacgcttgtttctttagtgtaaattctgctaaaaaagtcgaagaa
tttgtagatggatttgactcagcaaactcaagattaattgctaacctttcttacactatg
tgtatatcgagaatatctcattatattaaatgtgtaattagagataagattggtagtatt
gtggatgtcgagtcgattcaaaaaattctttctgattggatatcagaatttgtcaccaca
gtctatcaaccaacccctttagaaatggcgagatatcctttcagaaacgtttctatcgag
gttgaaaccataccgggtaagcctggctggtattcatgcaaaataaatgtaattccccac
attcaatttgaaggaatgaatactacaatgactatagatactaggcttgaaccagaatta
ttcggtacaaataataactaa

DBGET integrated database retrieval system