KEGG   Francisella tularensis subsp. tularensis TIGB03: FTU_1430Help
Entry
FTU_1430          CDS       T01762                                 

Gene name
hemD
Definition
(GenBank) Uroporphyrinogen-III synthase divergent Francisella type
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ftg  Francisella tularensis subsp. tularensis TIGB03
Pathway
ftg00860  Porphyrin and chlorophyll metabolism
ftg01100  Metabolic pathways
ftg01110  Biosynthesis of secondary metabolites
ftg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ftg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FTU_1430 (hemD)
Enzymes [BR:ftg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     FTU_1430 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AFB79442
Position
complement(1533790..1534539)
Genome map
AA seq 249 aa AA seqDB search
MKILVCRPQNDAVNLTEKLCANGLLAVSLPTIKICYQKITESVLDYTSLVFTSKYAVESL
FSQYPIYLFKNKKIYSVGASTAAILEKYQLAAIYPVRHGSQELLDIILNQDISKEKFAII
SGVSGNDLLLEELSKLTHCHKFETYLRVFIDLDELLDTYNKLFLHNQPDIIIATSLDVFK
SLNRIFEKITTPKAATITITSLKMLKFVNQQGFKNTLKLEKLDNSYICQRILEFTEAKDV
SRKKHPATK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatactagtttgtcgccctcagaatgatgctgtcaatttaacagaaaaactctgt
gcaaatggtcttttagcagtaagtttaccaactatcaaaatttgttatcaaaaaattact
gagagtgttcttgactatacaagtctagtttttactagtaaatatgctgttgaaagcttg
tttagtcaatatccaatctatttgtttaaaaataaaaagatctatagtgttggtgccagt
actgctgctatattagaaaaataccaattagctgcaatatatccagttagacatggctca
caagaacttttagatatcatattaaatcaagatatttctaaagaaaagtttgcgattatt
tctggtgtctctggtaatgatcttttgcttgaagagttatcaaaattaacacactgccat
aaatttgagacgtatttacgagtttttatagatcttgatgagttgttagatacttataat
aaactttttttacataatcagccggatattataattgctacaagtcttgatgtttttaaa
tcattaaatagaattttcgaaaaaataactactccaaaggctgcaacaattaccataaca
agcctaaaaatgctaaaatttgttaatcaacaaggctttaaaaataccttaaaacttgag
aaactagataatagttatatctgtcaaagaatactagaatttacagaggcaaaagatgtc
agtagaaaaaaacacccagcaacaaagtag

DBGET integrated database retrieval system