KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_0110
Entry
FTH_0110          CDS       T00399                                 

Definition
(GenBank) conserved hypothetical protein
Organism
fth  Francisella tularensis subsp. holarctica OSU18
SSDB
Other DBs
NCBI-ProteinID: ABI82152
Position
complement(111845..112996)
AA seq 383 aa
MSQIISTLNNIDLVTQDKVNLISNMQIQAKYENAEYKSFIDQLIDNLNTTRSIDIYNLFL
SLNSEICLNLDTVDNISKIISSYLSILNTNFTRISPSESKQKNQLAEKGINKFLVTMDAN
FAQMQNQDKLLPNNIDSIIEIVQEVIIFFEKNNLNYNSDFKIQLNKTLRKIKSSLILKDQ
KNDTYSDKESINQVEATITDQKTIQGSEKWKTLIEKIEVLKALVESERIFETSIVYNDIQ
NLLVNFDPKEYFPEIFFPLYKKIAPFIGNIHKNIDYYSSSIQWSIAQKMYNIDYKSFLDT
LEKMPENNFLNSSSDITKNFFYETSSEVEKTPIEEHKIIADTDAIKEEIVIKQRTNNKKN
QNDPVEKISNKIDEDYFEDLFDI
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgagtcagataatatctacactaaataatattgatttagtaactcaagataaagtaaat
ctgattagtaatatgcaaatacaagcaaaatatgaaaacgctgagtataagtcatttatt
gatcaattaatagataatcttaatactactagaagcatagatatatataacttatttcta
tctttaaattcagaaatatgcctcaatttagatacggttgataatatctctaaaattatt
agctcttatttatctattctaaatactaatttcacaagaattagtccatcagaatcaaag
caaaaaaaccagctagctgaaaaaggaataaacaaattcttagtcactatggatgcaaat
tttgcgcaaatgcagaatcaagacaagttgttaccaaataacatagattctattatagaa
attgtacaggaagtaataatattttttgagaaaaataacttaaattataattctgatttt
aaaatccaactaaataagactctcagaaaaataaaaagttctttgattttaaaagatcaa
aaaaatgatacgtattccgataaagaatcaataaatcaagttgaagcaactatcacagat
caaaaaaccatacaaggctctgagaaatggaaaactcttattgaaaaaattgaagtttta
aaagctctagttgaaagtgaaagaatatttgaaacatctattgtttataatgatatacaa
aacttattagttaacttcgatcctaaagagtattttccagaaattttctttccattatac
aagaagatagctccttttattggcaatatccataaaaacatagactactactcatcaagt
attcagtggagtatagctcagaagatgtacaacatagattataagagttttctagatact
cttgagaaaatgcccgaaaataattttttaaattcttcttctgatataactaaaaatttc
ttttatgaaacatcctcagaggtggaaaaaactcctatcgaagaacataaaataattgca
gatacagatgctatcaaagaagaaatagtaataaaacagcgaaccaataataaaaaaaac
cagaatgaccccgtagaaaaaatttcaaataaaatagatgaagactattttgaagatctt
tttgacatataa

DBGET integrated database retrieval system