KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_1124Help
Entry
FTH_1124          CDS       T00399                                 

Gene name
fba
Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
fth00010  Glycolysis / Gluconeogenesis
fth00030  Pentose phosphate pathway
fth00051  Fructose and mannose metabolism
fth00680  Methane metabolism
fth01100  Metabolic pathways
fth01110  Biosynthesis of secondary metabolites
fth01120  Microbial metabolism in diverse environments
fth01130  Biosynthesis of antibiotics
fth01200  Carbon metabolism
fth01230  Biosynthesis of amino acids
Module
fth_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTH_1124 (fba)
   00030 Pentose phosphate pathway
    FTH_1124 (fba)
   00051 Fructose and mannose metabolism
    FTH_1124 (fba)
  09102 Energy metabolism
   00680 Methane metabolism
    FTH_1124 (fba)
Enzymes [BR:fth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     FTH_1124 (fba)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase OST_P2
Motif
Other DBs
NCBI-ProteinID: ABI82994
Position
1095822..1096886
Genome map
AA seq 354 aa AA seqDB search
MALVSLRQLLDHAAEHGYGLPAFNVNNLEQVRAVMEAADKVNSPVILQGSAGARKYAGAS
FIRHLVLAAIEEYPHIPVCMHQDHGTSPSVCQRSIQLGFSSVMMDGSLKSDGKTPADYEY
NVNVTKTVSDMAHACGVSVEGELGCLGSLETGQAGEEDGIGAEGTLSMDQLLTDPEEAAD
FVRRTKVDALAIAIGTSHGAYKFTKPPTGDVLSIKRVKEIHARIPDTHLVMHGSSSVPQD
WLEVINTYGGAMGETYGVPVEEIVEAIKYSVRKINIDTDLRMAATGAIRRFLAENPAEFD
PRKYNAVAKAAMSEICAARYEAFGSAGMASKIKPISLEIMFQRYESGELDPIIK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggctttagtttcattgcgtcaactattagatcatgctgctgagcatggttatggatta
ccagcttttaatgttaataaccttgaacaggttagggctgttatggaagctgcggataag
gttaactcaccagttattttacaaggttcggctggagcaagaaagtatgctggagcatct
tttattaggcatctagttttagctgcaatagaagaatatccacatatcccagtatgtatg
caccaagatcatggtacatctccatcagtttgtcaaagatctatccaattaggtttttca
tctgtgatgatggatggttctctaaaatcagatggtaaaactccagctgactacgaatat
aatgttaatgttacaaaaacagtttctgatatggctcatgcttgtggcgtatcggttgag
ggtgagttaggttgccttggttcgttagaaactggacaagctggcgaagaagatggtata
ggtgctgaaggtactttatctatggatcaattacttactgaccctgaagaggcagctgat
tttgttagaagaactaaagttgatgctttagctatagctatcggtacttcgcatggtgct
tataagttcacaaaaccacctacaggtgatgtattatctatcaaaagagtaaaagagatt
catgcaagaatacctgatactcacttagtaatgcatggttcatcttctgtgccacaagac
tggttagaagtaatcaatacttatggcggtgctatgggagaaacttatggtgtacctgta
gaggaaatcgttgaagctataaagtatagcgtacgtaagataaatattgatacagatcta
cgtatggcagctactggtgctatcagaagatttttagctgagaatccagctgaatttgat
ccacgcaagtataatgctgttgccaaagcagcaatgtcagagatttgtgcggcccgttat
gaagcatttggtagtgctggtatggcgagcaaaattaagcctatatctcttgaaattatg
tttcaacgctatgagagtggtgagttagatccaattattaaataa

DBGET integrated database retrieval system