KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_1303
Entry
FTH_1303          CDS       T00399                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
fth00473  D-Alanine metabolism
fth01100  Metabolic pathways
fth01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fth00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    FTH_1303 (alr)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    FTH_1303 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fth01011]
    FTH_1303 (alr)
Enzymes [BR:fth01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     FTH_1303 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:fth01011]
 Precursor biosynthesis
  Racemase
   FTH_1303 (alr)
SSDB
Motif
Pfam: Ala_racemase_N Ala_racemase_C Orn_Arg_deC_N
Other DBs
NCBI-ProteinID: ABI83146
UniProt: Q0BL88
Position
complement(1276885..1277982)
AA seq 365 aa
MNILKISKQTLRNNIKIIREYIGNAKMCFPVKANAYGHGIEDIVENTHDLVDFFAVANSL
EAFRVTAVAKNPVLVFGVIYYEYIEKMISENIRVSIQDYEYIEKLEQIAKELDKKVYAHI
NINTGMNRMGVDYNDACRTIQRAYESDWLILEGVYSHLACADNRDHPTNIKQKNRFDSIV
KFTKGLSQDIICHLSNSYGFLGQKGICYDMVRPGILSYGFLPEFYVDRVIREIKPIARLL
SKVVKIITLQEGEGVGYSLIYRGFEGEQLAVIPIGYGDGFPRELGDRGFVNINDVMYPMA
GRMSMDGLTVSLGINEYDVKVGDTVELISAIPRNRNSAFSIAKQINTIEYDIMSTLNDRI
IRKII
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgaatattctaaagattagtaaacaaactttaaggaataatattaaaattattcgagag
tatattggcaacgctaagatgtgttttcctgtcaaggcaaatgcttatgggcatggtata
gaagacatagtagaaaatacacatgatttagtcgatttctttgctgttgctaactctcta
gaggcttttagagtaacagctgttgctaaaaatccagtgctagtatttggagtaatatac
tatgaatatattgaaaaaatgatttcagaaaatatcagagttagcattcaagactatgaa
tatattgaaaagttagagcaaatagccaaagagcttgataaaaaagtatatgcccatatt
aatataaacacaggtatgaatcgcatgggcgtagattataatgatgcctgtagaactata
cagcgagcttatgaatctgattggctaattttagaaggagtatatagtcatctagcatgt
gctgataatagagatcatcctacaaatatcaaacaaaaaaatagatttgatagtattgtc
aaatttactaaaggattatctcaagatattatttgtcatttgtctaattcttatggtttc
ttgggtcaaaaaggaatctgttatgatatggtaagacctggtattttaagttatggtttt
ttaccagagttttacgttgatagagttataagagaaataaagcctatcgcaagattacta
tcaaaagtggttaagataattaccttgcaagagggcgaaggcgttggttattcattgata
tatagaggctttgaaggtgagcaattagctgtgattcctattggttatggcgatggtttt
cctcgtgagttaggtgatagagggttcgttaatattaatgatgtcatgtatcctatggct
ggtagaatgagtatggatggtctgacagtatcgttaggaattaatgaatacgatgtcaaa
gtaggcgatacagtagagctaatatcagctattccacgcaatcgaaatagtgcattttca
atagcaaaacaaataaatactatcgaatatgatattatgagcacattaaatgatcgtatt
ataagaaagatcatataa

DBGET integrated database retrieval system