KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_1548Help
Entry
FTH_1548          CDS       T00399                                 

Gene name
hemB
Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
fth00860  Porphyrin and chlorophyll metabolism
fth01100  Metabolic pathways
fth01110  Biosynthesis of secondary metabolites
fth01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FTH_1548 (hemB)
Enzymes [BR:fth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     FTH_1548 (hemB)
Exosome [BR:fth04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FTH_1548 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABI83344
Position
complement(1530946..1531920)
Genome map
AA seq 324 aa AA seqDB search
MSFPISRPRRLRVTQAFRDIVAETTLSLDDLMYPIFVVHGQGVKKEISSMPNQYHWSVDM
LDELVDQVVKAGIRSLMIFGVPKIKDLVSSENYDPNGITQQAIRKIKQLAPELVIATDVC
MCSFTPHGHCGILDEHDYVDNDQTLEILQKTAVSHAQAGADIVAPSGMMDGMIIAMRQAL
DEASFENVSIMSYSVKYASAYYGPFRSACSSSLKGDRKTYQMDYRNKKEAICEALADIEQ
GADFIMVKPALSYLDIVNELSHIIDLPIAAYHVSGEYAMIKAAASAGLVDEKAITIETLI
SMKRAGAKVILTYTALDVANWLKV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagctttccaatatcacgtccacgtagacttagggttacacaagcttttcgcgatatc
gttgctgagacaactttaagccttgatgacttaatgtatccaatatttgttgtgcatggt
caaggagttaaaaaagaaatttcaagtatgccaaatcaatatcattggtcagttgacatg
cttgatgagttagtagatcaagttgtcaaggctggaataaggagtctaatgatatttggc
gtgccaaaaatcaaagatcttgtttcatcggagaattatgatcctaatggaataacacag
caagcaattagaaagattaaacaacttgctcctgagcttgtgatagctacagatgtatgt
atgtgtagttttacaccacatggtcattgtggaattttagatgagcatgattatgttgat
aacgatcaaacattagaaatattacaaaaaacggctgtttctcatgctcaagctggagca
gatattgtagcaccaagtgggatgatggatggtatgataattgcgatgcgtcaggcacta
gatgaggcaagctttgagaatgtgagtattatgtcatactcagttaaatatgcatcggca
tattatggaccatttagaagtgcttgtagttcgtcacttaagggagatcgtaaaacttat
cagatggattatcgcaataagaaagaggcaatctgtgaggcgcttgcagatattgagcag
ggtgcagattttattatggttaaaccagctttgagttatctggatattgtcaatgagtta
agtcatattatagatttaccaatagcagcatatcatgtcagtggtgaatatgcgatgata
aaagctgctgctagtgctggtttagttgatgaaaaagcaatcactatagaaacactcata
tcaatgaaaagagcaggtgctaaagtgatacttacatatactgcgttggatgtggctaat
tggttaaaggtttaa

DBGET integrated database retrieval system