KEGG   Francisella tularensis subsp. holarctica FSC200: FTS_0183Help
Entry
FTS_0183          CDS       T02350                                 

Definition
(GenBank) polar amino acid uptake transporter
  KO
K01713  cyclohexadienyl dehydratase [EC:4.2.1.51 4.2.1.91]
Organism
fti  Francisella tularensis subsp. holarctica FSC200
Pathway
fti00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fti01100  Metabolic pathways
fti01110  Biosynthesis of secondary metabolites
fti01130  Biosynthesis of antibiotics
fti01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fti00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FTS_0183
Enzymes [BR:fti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     FTS_0183
    4.2.1.91  arogenate dehydratase
     FTS_0183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 FERM_N_2 Lig_chan-Glu_bd
Motif
Other DBs
NCBI-ProteinID: AFT92178
Position
complement(186392..187132)
Genome map
AA seq 246 aa AA seqDB search
MKKTVFTFITAIAVMISSAYADITVGTTGDYAPFSVYNPKDNKYSGKDIKLIEAFAKNKK
EQVKFVKTSWATAENDLKSNKFDVFVGGMTITPERQKEFVFSNPLISFNKAAMTACKKLN
KYKTFNDIDNPKTLVIENRGGTNQVFALQKLKNAKVLIISDNNQAINSIIKGIDNIHPDI
MFTDTLEIAYQHSKNHKICQVHVKVDDNQYYKAFMFNNTSQGKKIAQEFDNWLNNNPTIL
KKYTKS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaccgtatttacatttataactgctattgcagttatgatttctagcgcatat
gctgatattaccgtaggaacaacaggcgattatgcgccattttcagtttataatcccaaa
gataataaatactctggtaaggatataaagctcatagaagcttttgcaaaaaacaaaaaa
gaacaagtaaagtttgtcaaaacttcttgggcaactgctgagaatgatttaaaaagcaat
aaatttgatgtttttgttggaggaatgacaataactcctgaacgtcaaaaagaatttgtc
ttttcaaacccattaatatcatttaataaggcagctatgactgcttgtaaaaagttaaat
aagtataaaacttttaatgatattgataatccaaaaacattagttattgaaaatagaggt
ggtacaaatcaagtatttgcattacagaaattaaaaaatgctaaagtgctaataataagc
gataataaccaagcaataaactctatcataaaaggtatagataatattcatcctgatatt
atgtttacagatactttagaaatagcttatcaacattctaagaaccataagatatgccaa
gtacatgtaaaagttgatgataatcaatactacaaagcctttatgtttaataatacatca
caaggtaagaaaattgctcaagagtttgacaactggcttaataataacccgactatcctt
aaaaaatatacaaaatcttaa

DBGET integrated database retrieval system