KEGG   Francisella tularensis subsp. holarctica FSC200: FTS_0453Help
Entry
FTS_0453          CDS       T02350                                 

Gene name
nadM
Definition
(GenBank) bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase
  KO
K13522  bifunctional NMN adenylyltransferase/nudix hydrolase [EC:2.7.7.1 3.6.1.-]
Organism
fti  Francisella tularensis subsp. holarctica FSC200
Pathway
fti00760  Nicotinate and nicotinamide metabolism
fti01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fti00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    FTS_0453 (nadM)
Enzymes [BR:fti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     FTS_0453 (nadM)
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     FTS_0453 (nadM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AFT92384
Structure
PDB: 

Position
429221..430264
Genome map
AA seq 347 aa AA seqDB search
MYDISVFIGRFQPFHKGHLHNIIIALQNSKKVIINIGSCFNAPNIKNPFSFEQRKQMIES
DLQVAGIDLDTVVIEPLADYFYQEQKWQDELRKNVYKHAKNNNSIAIVGHIKDSSSYYIR
SFPEWDYIGVDNYKNFNATEFRQKFYNGIISKQYMCSNDPKLGTYNFLTKFMDTQVYQDL
VAENNYVIEYKRLWLKAPFKPNFVTVDALVIVNDHILMVQRKAHPGKDLWALPGGFLECD
ETIAQAIIRELFEETNINLTHEQLAIAKRCEKVFDYPDRSVRGRTISHVGLFVFDQWPSL
PEINAADDAKDVKWISLGSNIKNICDRMLEDHYQIITILLEECGKKL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatatttcagtttttataggaagatttcagccttttcataagggtcacttacat
aatataataatagcgctacaaaatagcaaaaaagttataattaatattggtagttgtttt
aatgcaccaaatataaaaaaccctttttcttttgagcaaagaaaacagatgatagagagt
gatttacaagtcgctggaattgatttagatactgtagtcatagagcctttggctgactat
ttttatcaagaacaaaagtggcaggatgaattacgtaaaaatgtctataagcatgctaaa
aataataatagtatcgctatcgttgggcatattaaggatagttctagctattatataaga
agttttcctgaatgggattatataggagttgataattataaaaactttaatgccactgaa
tttaggcaaaagttttataacggcattatatcaaagcaatatatgtgtagtaatgaccct
aaattaggtacttataactttttgacaaagtttatggatacacaagtatatcaagactta
gttgcagaaaataattatgttattgagtataaaagattatggctgaaagctccatttaag
ccaaactttgtgacggttgatgctttagttatagtgaatgatcatattctgatggtacag
aggaaagctcaccctggcaaagatttatgggcactgcctgggggatttctagagtgtgat
gaaactatcgcacaagctataattcgagaattatttgaagaaacaaatatcaacctaact
catgagcaactcgctatagcaaaacgctgtgaaaaagtttttgattatcctgatcgttca
gtaagaggtagaacaattagccatgttgggttgtttgtttttgatcaatggccaagctta
ccagagattaatgctgccgatgatgcaaaggatgtcaaatggatatctttgggctcaaat
attaaaaatatctgtgatagaatgttagaagatcattatcaaattatcacgattttatta
gaggaatgtggtaaaaaactataa

DBGET integrated database retrieval system