KEGG   Francisella tularensis subsp. holarctica FSC200: FTS_0747Help
Entry
FTS_0747          CDS       T02350                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
fti  Francisella tularensis subsp. holarctica FSC200
Pathway
fti00471  D-Glutamine and D-glutamate metabolism
fti01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fti00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    FTS_0747 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fti01011]
    FTS_0747 (murI)
Enzymes [BR:fti01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     FTS_0747 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:fti01011]
 Precursor biosynthesis
  Racemase
   FTS_0747 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AFT92620
Structure
PDB: 

Position
740018..740815
Genome map
AA seq 265 aa AA seqDB search
MLDNRPIGVFDSGIGGLTIVKNLMSILPNEDIIYFGDIARIPYGTKSRATIQKFAVQTAK
FLIDQEVKAIIIACNTISAIAKDIVQEIAKAIPVIDVITAGVSLVDNLNTVGVIATPATI
NSNAYALQIHKKNPNIEVYSNPCGLFVSMIEEGFVSGHIVELVAKEYLSYFHDKNIQTLI
LGCTHYPIIKESIAKILDVKLIDPSLQASKMLYSLLFENKLLNTTKSNPEYRFYVTDIPL
KFRSVGEMFLQTEMQHLEIVSLDSY
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcttgataatagacctataggtgtttttgattcgggaatcggaggtttgacaattgtt
aaaaacctcatgagtatattaccaaatgaggatattatctattttggtgatatagctagg
ataccttatgggacaaaatcgcgagctacgattcaaaagtttgcagtacaaacagcaaag
tttttgattgaccaagaggtcaaagcaatcattattgcttgtaatactatttcagctatt
gctaaagatatagtccaagagattgctaaagcaataccggtaatagatgtaataacagct
ggtgtaagcttagtagataatttaaacacagttggtgtaattgctactccagcaaccatc
aatagtaatgcatatgctttacaaattcataaaaaaaatcctaatattgaggtgtatagt
aatccttgcggtttatttgtatcaatgatagaggaaggctttgttagtggtcatatagta
gaactagtagctaaagagtaccttagttattttcatgataagaatattcaaaccctgatt
ttaggttgtacacattatccaattatcaaagaaagtattgcaaaaattttagatgtaaaa
cttatagatccatcattacaagctagcaaaatgctttattcgttactttttgagaataag
ctcttaaacactactaaatctaatccagaatataggttttatgtaactgatattcctttg
aaatttagatcagttggtgagatgtttctgcaaacagaaatgcaacatcttgagatagta
agtttagatagctactaa

DBGET integrated database retrieval system