KEGG   Francisella tularensis subsp. holarctica FSC200: FTS_1742Help
Entry
FTS_1742          CDS       T02350                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
fti  Francisella tularensis subsp. holarctica FSC200
Pathway
fti00020  Citrate cycle (TCA cycle)
fti00190  Oxidative phosphorylation
fti00650  Butanoate metabolism
fti01100  Metabolic pathways
fti01110  Biosynthesis of secondary metabolites
fti01120  Microbial metabolism in diverse environments
fti01130  Biosynthesis of antibiotics
fti01200  Carbon metabolism
Module
fti_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fti_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fti_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fti00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FTS_1742 (sdhD)
   00650 Butanoate metabolism
    FTS_1742 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    FTS_1742 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DoxX
Motif
Other DBs
NCBI-ProteinID: AFT93361
Position
complement(1718361..1718729)
Genome map
AA seq 122 aa AA seqDB search
MGVLLMAVISLTSSGIKDFFVQRVTAVIIAVYFGYLILEALYLSHIGALNYDSWRGLFTD
GMFFRVATLMVYLAMFFHAWVGIWIICGDYIKFAWAFALVMLSFVLVYIFCFFWLFAVLF
FY
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgttacttatggctgtaatttcattaacttcttctggaattaaagactttttc
gtacaaagagttacggctgtaattattgctgtatattttggttatcttatcctagaagct
ttgtatttgtcgcatataggagctcttaactatgatagttggagaggtttgtttaccgat
gggatgttttttagagttgctacgttaatggtgtacttggcgatgttttttcatgcatgg
gtaggtatctggattatatgtggcgattatattaaatttgcttgggcttttgcgcttgtg
atgctgagctttgttttggtgtatatattctgctttttttggttatttgcagttttattt
ttctattaa

DBGET integrated database retrieval system