KEGG   Francisella tularensis subsp. holarctica LVS: FTL_0116
Entry
FTL_0116          CDS       T00331                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ftl  Francisella tularensis subsp. holarctica LVS
SSDB
Other DBs
NCBI-ProteinID: CAJ78557
Position
complement(107403..111389)
AA seq 1328 aa
MNDKYELNIYFEKIELPKTADFNMISKHDIKELRVDANLKKKIHLLQFDEDYLAYMRSLR
AIHPSKIAMQKIKSIRNKKNSFIIAILSLDKIIHKTKFITFGHKTVIFDFKKLWGLVDFV
IVHTSNKTWVNHKLTSFMPSITYCNQNIIHLAYHSDFLYIYHTPEFMDDINVDRENRRRL
VAKIPDPYWVRADTKENKINITSENKNLEKDLKKITKLKNFEISANDIFFSKAIKAAPRL
QHKNKSKLFNSLAIENNEKIKRDIIDYAISNAWYKNDGLLENLMTFLDALVVRHLYLIAV
YSVYEIEIGIKSVKPEYSKLLKAGLLNKDIQNQLIYDQKKISNIIWLGETFHGLDIEEAQ
ALCEFLDEENINPKINPINSKKLYKTYKENYKSDSEKILSFTKYKEKYNFLNNDKLREEH
ANKLSSILEDPKFRVLSYINAFLCSTKNYLVPYGYLGSNPLTYYNCMLETGKRRTSKEAY
FADIRNKLFIVCYLPGFLSSVIADDDFIDWYSNKKENQELLKNSYLNNLYNSKQKYIKDF
IDLDIIKLLKQTSSQIKPSYIPVAFRYGAFASTTALIRSNANVSNRMEFELYDSPERLHN
QYLEKEEMIMPKSVNNPKDHSIDNGVSLFSLNLTNEKEDGLRKVMLKVAQLYNLDFKVGI
SGNLDQAMTQALILGMATTKKNGDIVIDEDQVLYMTYLYCIFMAHSVDHTVDEILMSSNT
YMLNSKEEKYPIANIANFFARPVFKLSKDKEFKALVEKYENSIKPNSKVLKENYISRVTT
LSEVYEDIYNLNCLYSSLSEGSLYNLLSTHSERNCTLLEQYSRKKKAETGLVQDGEKIKV
VNNYNGYAAINQYQRFVSLGIMYDSGAKYSSSHKKQIEKDFNLYSPDKEQINYLKYNFKD
NKFDAVYKNKKSKEKTQSHIVYAKKQNTRYCYGYFNNFFVKNRITTFYKIKDKSGNYLVN
LHNEKYSFATPNSDSKIYRASPELLNNRDDFKRVSKDIIKSYKYISFDKQKEDIVKNFGK
NLYHTNYEIWVGLSHQAISCFSVLDNIDTQEAANTFIDALYYIRLMQLYYGKTIPFLLIS
SEIVRYSSSETHYYIPTEENFENILKIALNSASKPVIERFLIILNIYNNTIDDNTLILIR
CRLTIILFEHEEQKLKLKALQKYADAYKKNNYKNEINFRAWFESIFHVQNLSLSPNYIGN
NILILSLVEELKPKCSEYKKNMINQQIIAKANELNFYQLIIRLIEISTYHRILTKSIITN
TTSLLYDILNKPEFQTINKSINKLFIYKNKDLNTDKYKAFHTKLITIEKTYKKINSLYKS
DFFKKISS
NT seq 3987 nt   +upstreamnt  +downstreamnt
atgaacgacaaatatgaactaaatatctattttgagaaaatagagttacctaaaacagca
gatttcaatatgataagtaagcatgatattaaagaactcagagtagatgctaatttaaaa
aagaaaatacacttattacaatttgatgaagattatttagcatatatgaggagcttaaga
gctattcatccctcaaaaatagcgatgcaaaaaattaaatcaattcgcaataaaaaaaat
tcttttataattgccattttatctttagataaaataattcacaaaactaaatttatcact
tttggacataaaaccgttatttttgattttaagaaactatggggattagttgatttcgta
atagttcatacaagtaataaaacctgggttaatcataagttaacatcatttatgccatca
attacatactgtaatcaaaacatcatccatttagcataccattctgattttttatatatt
tatcatactccagaatttatggatgatataaatgtagatcgagaaaatagaagaaggtta
gtggcaaaaattcccgatccatattgggtaagagctgatactaaagaaaataaaatcaat
attacttctgaaaataaaaatctagaaaaagatttaaaaaaaataactaaattaaaaaat
tttgaaataagcgcaaatgatatttttttctcaaaagctataaaagcagctccaagatta
caacataaaaataagagtaaattatttaattcattagcgattgaaaataatgaaaaaatc
aaacgtgacataattgattatgcaatatctaatgcttggtataaaaacgatgggttactt
gaaaatctaatgacatttttagacgctctagtcgtaagacatctctacttaatagcagtt
tactcagtttatgaaatagaaataggtattaaatcagtaaaacctgagtatagcaaatta
ttaaaagctggcctattgaacaaagatattcaaaatcaattgatatatgatcaaaagaaa
attagcaatattatttggcttggtgaaacatttcatggtttagatattgaagaagctcag
gctttatgtgagtttcttgatgaagagaatattaacccgaaaattaatcctataaattct
aaaaagctatataaaacctacaaagaaaattataaaagcgattcagaaaaaattttaagt
ttcacaaaatacaaagagaaatataattttttaaataatgataagcttagagaagaacat
gcaaataaactttcaagcatattagaagatccaaaatttagagttcttagctatataaat
gcatttttatgttcaactaaaaattatctagtaccttatgggtatttaggaagtaatcct
cttacatactataattgtatgctagaaaccggaaaacgtagaacatcaaaagaagcatat
tttgctgatataagaaacaaattgtttatagtatgctatcttcctggcttcttgagctct
gtaattgctgatgatgactttatagactggtattctaataagaaagaaaatcaagaatta
ctcaaaaactcttatttgaacaatttatataactcaaagcagaaatatataaaagatttt
atcgatcttgatattattaaacttctaaaacagacatcatctcaaatcaagccaagctat
ataccagtagcttttagatatggtgcatttgcctcaacaactgctttgataagatcaaat
gcaaatgtttctaatcgaatggagtttgaattatatgactcacctgaaagactacataat
caatacttagaaaaagaggaaatgattatgccaaaatcggttaataaccccaaggatcac
tcaattgacaatggagtgtctttatttagccttaatctaacaaatgaaaaagaagatgga
cttcgaaaagttatgttgaaagttgcacaactatataatcttgatttcaaggtaggtatc
tcaggaaatttagatcaagcaatgactcaggcattaatactcgggatggcaactacaaaa
aaaaatggagatatcgtaattgatgaagatcaagtgctatatatgacatacttatactgc
attttcatggcacatagtgtcgatcatactgtagatgaaatactaatgtcctcaaatact
tatatgttaaattctaaagaggaaaagtatcctatagccaatatagctaatttttttgct
agacctgtatttaaactttctaaggataaagagtttaaagcattagttgaaaagtatgaa
aatagcataaaacctaattcaaaagttctcaaagaaaattatataagtagagtaacgacg
ttatccgaggtatatgaagatatatataatttaaattgcttatatagttctctatcagaa
ggatccttgtataacctattatcaactcatagtgaaagaaactgtactttattagagcag
tattctcgtaagaagaaagcggagacaggattggtccaagatggagagaaaataaaagtc
gtaaacaactacaatggctatgctgctattaatcaatatcaacgttttgtatcactaggc
ataatgtatgatagtggtgcaaaatactcctcttctcataaaaaacagatagaaaaagat
ttcaacttatactcaccagataaagaacagataaattatctaaaatataactttaaagat
aataaatttgatgctgtttataaaaacaaaaagagcaaagaaaaaactcaaagccatatt
gtgtatgcaaaaaaacaaaatacgcgatattgctacggatattttaacaattttttcgtt
aaaaatagaattacgactttttataaaataaaagataaatcaggaaactatttagtaaac
ttacataatgaaaaatatagtttcgcaacacctaattcagattctaaaatatatagagct
tcaccagaattacttaacaatagagatgattttaaaagagtatctaaagatattataaaa
tcatataaatatattagttttgataaacaaaaggaagatatagttaaaaattttggtaaa
aacttatatcatactaattatgagatatgggtcggactatcacatcaagctatatcatgt
ttttcagttttagataacatagatacacaagaagctgctaatacttttatcgatgcttta
tattatattagattaatgcaattatattatggcaaaactataccttttttgttgattagt
agcgaaattgtaagatattcttcatcagaaactcactactatataccaacagaagaaaac
tttgaaaatatacttaaaattgctcttaatagtgcctcaaaaccagtaatagaaagattc
ttaattattcttaacatatataataacactattgatgataatactttaattttaatacga
tgccgtttaacaataatattatttgaacatgaagagcagaaactcaaattaaaagcttta
caaaaatatgctgacgcttataaaaaaaataattataaaaacgaaattaattttagagct
tggtttgaatctatatttcatgttcaaaacttatccttatctcctaattatattggcaat
aatattttaatcttgagtttagttgaagaattaaaaccaaaatgtagtgaatataaaaaa
aacatgattaaccaacaaattatagctaaagcaaacgagttaaacttttatcaacttata
ataagacttattgaaatatcaacctatcatagaatacttacgaaatcaatcataactaat
acaacctcgttactttatgacatattaaataaaccagaatttcaaacaataaataaatca
ataaataagctatttatttataaaaacaaggatctaaatactgataaatataaagccttt
cacactaagcttataactattgaaaaaacctataagaaaataaatagcttatataaatca
gacttttttaaaaaaatatcatcatag

DBGET integrated database retrieval system