KEGG   Francisella tularensis subsp. holarctica LVS: FTL_0119
Entry
FTL_0119          CDS       T00331                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ftl  Francisella tularensis subsp. holarctica LVS
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: CAJ78560
Structure
PDB: 
4ACK 4ACL

Position
complement(113341..113964)
AA seq 207 aa
MKDFKEIEIILDIIKTTREIIEDNDNDNEKISYHRNNIRKSIFFLQEELLEKYSETVCKY
IVFPLLAYVDEKLMLLREKSASNISWSLLQLEYYDRKDGGEYVFEITDNILSENIYPEIC
YQTISLILHNDFYGKYYDNIYNHSFLAYKKEIDKHIENSTIDSVNFIDIPVNSPPLSRKY
SKTLKFLLRIGVPLGLFLLSLLILLSW
NT seq 624 nt   +upstreamnt  +downstreamnt
atgaaagactttaaagagatagaaattattctagatattataaaaactacaagagaaatt
atagaagataatgataatgataatgagaaaatatcataccatcgtaataatataagaaaa
agtattttcttcctacaagaagagctcttagaaaaatatagtgaaactgtctgtaaatat
atagtttttccgttacttgcatatgttgatgaaaaattgatgctacttagggaaaagtca
gcaagcaatatttcttggagtctattacaattagaatattatgatagaaaagatggcggt
gaatatgtttttgagataactgataatattttatcagagaatatctatccagaaatttgc
taccagacaatatcacttatcctacacaatgacttctatggcaaatactatgacaatata
tataaccatagctttcttgcttataagaaagaaattgataagcatatagaaaattcgaca
attgattcggttaattttattgatatacccgttaatagccccccactgtcaagaaaatat
agtaagacgcttaaattcttattaagaataggcgttcctttaggactgtttcttttaagc
ttactaattttattaagctggtaa

DBGET integrated database retrieval system