KEGG   Francisella tularensis subsp. holarctica LVS: FTL_0125
Entry
FTL_0125          CDS       T00331                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ftl  Francisella tularensis subsp. holarctica LVS
SSDB
Motif
Pfam: IcmF_C
Other DBs
NCBI-ProteinID: CAJ78566
Position
complement(118552..121833)
AA seq 1093 aa
MNFIKNHQILIISLTIAIIVLSVLGIFMIKKWLKTSRNPNKKSASKTIKNAKSLIKKNKV
KNNLSELYIFYGDYLAAKDYITKIKPQAQIIDNNELPLIAIDKNNTSLVFANNEFSYLYK
LKKKLNLQFYKLNFCFDISDDYYHENIKISEIYKELLKLRLKNFIISFYTLSEHTRSYNN
AIDKKSIFKLTSDADTNHKAEEEILSKILSSKDDVNNKYNNVKILNQIRKLLKNIHPQLK
SINKETFFNFGLNTPDNIIAKKDTIFFSSFPKSIIINLISLLFSFIFIVNIFQEINIKKK
FSIQELNQLHESDSNKIIEETRKKIDEAILLDILYPKSIKYHFIYKQYADTLLKNVILPK
YNDTYDLSMITSFLIFFEYLDNKIINQHTNRILKIISSITNLSEKQLDIVVKYTTPSIRT
EMIKSAINRANKLYTNRLIVVGKDSKSYLSTKGFNAEYLGISNTKRAKVINNIYIQYLYK
CATDNAILDLNDNYIIPIEVNNIFKMYQEQFDTSSKKLCNSSYINSITKSVSLILNQEEN
KRKFESFSDMLDHIYYLVKSLEKNAKDVADDGKKQTSSITVSLINYVINSVVNPTYNKNE
LPLISPVSKNLYMEFAPNFYSKRILISPIYSKEYIKDNIDPTNKKFNRLVNNLKNNFNIE
PDFMIAIYKSSINNYIEKYIGSYNKMIDSLNNDSEFNKNISNKGALKLYLLAMSSKDSSF
NSLIEFYSTNTDLITNESETNSSKKINKLQHFYGEITKLNKQNNTNDQNDKSLWAPIDNY
FKENDKYLESKSYADYKNIFKQLNNLIIEQGYSSTYKNIKQGYEPLQKVYSELSKINNHQ
GNNNLYKLLKKHLDIAINTIKTIAIQDAITKLDNTVNIEYEYINNQFPFNKDSNSAATNE
AITKDFDNNGYIYSGFIEQLSPLLFYNKTDDRWESKDFSKPEEIDYLNKFNKVYLLNKLL
WDDKINPKAIKFDITPIPNKDNDYTFFSIILDKQNYVNSLNIKYSDSIEVLYNWNSLEST
TITIKFEDGSNEQISYQGKWSILKAIKDANCDQNNICTWIIKHKGKKYPLSFKIESKFLQ
VLGWQKQGEVNVQ
NT seq 3282 nt   +upstreamnt  +downstreamnt
atgaattttattaaaaatcatcaaatattaataatttcactaactatagcaataattgtt
ttatcagtacttggtatttttatgattaaaaaatggcttaaaacatcaagaaatcctaac
aaaaaatctgcctcaaagaccataaaaaatgcgaaatcattgatcaaaaagaataaagta
aaaaacaacttaagtgaattgtatattttctatggggactatctggcagctaaagattat
ataacaaagataaaacctcaagctcaaatcattgataataatgaactccctttaatagct
attgataaaaacaatacatctctcgtatttgcaaataatgaattttcgtacctatataag
ttaaaaaagaaactaaatctacaattttataagcttaacttttgcttcgatatatccgat
gattactatcatgaaaatatcaaaattagtgaaatctataaagaactattaaaattaaga
ttaaaaaacttcataatatctttttacaccttatctgagcatactagaagctataataat
gcaattgataaaaaatcaatatttaaattaacttctgatgcggatacaaatcataaagct
gaagaggaaatattatcaaaaattcttagctctaaagatgatgttaataataaatacaat
aatgttaagatattaaatcaaataagaaagttgctaaaaaacatccaccctcaattaaaa
tctataaataaagaaacattctttaattttgggctaaacacaccagataatatcatagca
aagaaagatacaatattttttagcagctttccaaaaagtattatcataaacttaatatct
ttgttatttagttttatatttatcgttaatatttttcaagaaattaatattaaaaaaaaa
ttctctatacaagaacttaatcaactacatgaaagcgactctaataaaataatagaagaa
actagaaaaaaaattgatgaggctatacttctagatatcctatatccgaaatcgataaaa
tatcatttcatatacaaacaatatgctgatactctcctaaagaatgtaatcttaccaaaa
tataatgatacatatgacttatcaatgattacatcatttttaatattttttgagtatttg
gataacaaaattattaaccaacatacgaatagaatacttaaaataataagcagtatcacc
aacctatctgaaaagcagctagatatcgtggtcaagtatacgaccccaagtataagaact
gaaatgattaagtcagccatcaacagagcaaataaactttatacaaatcgtttaatagtt
gtaggtaaagactccaaaagttacttaagtactaaaggatttaatgctgaatacttaggg
atttcaaatactaaaagagcgaaggtcataaataatatttatatacaatacctatataaa
tgtgctacagataatgcaattttagatttaaacgataactacataataccaatagaagta
aataatatcttcaagatgtatcaagagcaatttgacacatcctctaaaaagctatgtaac
tcatcatatattaactctattacaaagagcgtttctttgatacttaatcaagaggaaaat
aaaagaaaatttgaaagcttcagtgatatgctagaccatatctattatttagtaaaatca
ttagaaaaaaatgctaaagatgtcgcagatgatggtaaaaaacaaactagctcgataaca
gtatcgcttataaattacgttataaatagtgttgtcaaccctacttataataaaaatgag
ctcccactaataagtccagtaagtaaaaacctatatatggagtttgctcctaatttctat
agtaaaagaatacttatctctccaatatactcaaaagaatatattaaagataatatagat
cctacaaataaaaagtttaatagactcgtcaataatctaaagaataacttcaatatagaa
cccgactttatgattgctatctataaaagctctataaataactacattgagaaatatata
ggatcctataataagatgattgatagccttaataatgactctgaatttaacaaaaatata
tctaacaagggtgctcttaaattatatttgctagcaatgtcatcaaaggattcttccttt
aatagcctaatagagttttatagcactaatacagacctaataactaatgaatccgaaacc
aattcatctaaaaagataaataagcttcaacatttttatggagaaataactaaattaaac
aaacaaaataatactaatgatcaaaatgataagtcattgtgggcgcctatagataactac
tttaaagaaaacgataaatatcttgagtctaagagttatgccgactataaaaacatattt
aaacagttaaataatctaataatagaacaaggctattcaagtacatataaaaatatcaaa
caaggatatgaaccactacaaaaagtttactctgaactttctaagataaataatcatcaa
ggtaataataacttatataaactgttgaagaaacatctagatattgccattaatactata
aaaactatcgccatacaagatgctataactaaacttgataatactgtcaatattgagtac
gaatacataaataatcaattcccttttaataaggatagtaactcggctgcaacaaatgaa
gctataaccaaagactttgataacaatggttatatatactctggatttatagagcaacta
tctccactacttttttataataaaactgatgatagatgggaaagtaaagatttttcaaaa
cctgaggaaatagactatctaaataaattcaataaggtatatcttttaaataagctacta
tgggatgataaaataaatccaaaagctataaaatttgatataactcctataccaaacaaa
gataatgattatacattttttagcataatcctcgataagcaaaactatgtaaactcatta
aacataaaatattcagatagtattgaagttttgtacaactggaattcacttgagtcaaca
actattaccataaaatttgaggatggtagtaatgagcaaataagctatcaaggaaaatgg
tctatattaaaagcaattaaagacgcaaattgtgatcaaaacaatatttgtacctggata
atcaagcacaaaggtaaaaaatatcctttaagcttcaaaatagaatcaaaattcttacaa
gtattaggatggcaaaaacaaggagaagtcaatgtacaataa

DBGET integrated database retrieval system