KEGG   Francisella tularensis subsp. holarctica LVS: FTL_0669Help
Entry
FTL_0669          CDS       T00331                                 

Definition
(GenBank) Exodeoxyribonuclease V beta chain
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
ftl  Francisella tularensis subsp. holarctica LVS
Pathway
ftl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ftl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    FTL_0669
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ftl03400]
    FTL_0669
Enzymes [BR:ftl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     FTL_0669
DNA repair and recombination proteins [BR:ftl03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     FTL_0669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 AAA_12 AAA_30 Helicase_RecD Cucumo_coat Lys DUF3585
Motif
Other DBs
NCBI-ProteinID: CAJ79108
Position
653661..657314
Genome map
AA seq 1217 aa AA seqDB search
MDNLNANIITLQGRHIIEASAGTGKTFNITKLYIRLLLEKKLLPSNILVMTFTKDATQEI
IGRVEKEIRDVLASYTDEKKESDKENYKHLKRSLLEIDEAAIFTIHGFCKKVLSEQAFAS
GIEMDVSMEVDTSDIFQKVVEDFFRKHINKSETNFGYLQIYKLHTPEKFLDDLENIIRSN
YEILTKQAISLDEFKILKKQQLELFINNHDIVDDFLYKLGKSEPQGKRVDEYHRVLEWLK
LDNQTLFPENISIITDGRKISAKLIKPIFIGVKELRDLQQEIKQAQAAQFIRKACLQIRQ
DFAKAKDQKGVLDFDDLITKLCQSVKKSPELVKTLQKQYPVALIDEFQDTDAEQYEILDT
IYPLKNSSSHSHKGKNLLTNGLNLKDTRLREYDSSSDQNDSNLLLLMIGDPKQAIYGFRG
GDIFTYLKAKDSCPEENQWSMDTNWRSTGEMIKAYNRLFYKQDYQSEEEGQIGTNIFSDG
IGYQLVKASPDADKKTKDFDDNFKPINYFYYEVAEDDNKSDIDTNLALWTVNEITRLLNT
QKVAENDIAILVENGKQAKIIQQALQAKNLSSVYLSQRDNVYHSQEAKEILALMEGINDL
ENKSMLKRALSTSLLGGRADKFISYIDENDVSAWDDEIEKAKSLRQQWHKYGFMAFIMQI
IHENFTQKADSKERIITNILHLAELIKVAENKYKHPNQLIKWYRHQLNNTATSEGELRLE
SDDNLIKIITIHGSKGLEYSVVFIPFACYASTKKFETSNFTKYYDGDLKQTVYKIGKDDS
VKQQADKEVIEELMRLFYVAVTRAEHRCYIGVAKYNNSEKSPLARFLGYQKDDDWLEKIQ
SITANPANQSLLINIADMREFSLKNLSSKDKNSDYDTLKANYISKLENDSWEMLSFSKIS
KSKVQNTALEKEIDEAEDDKTQASDRKLAFRFTASKGADMGNILHNVLEHTDFSLGEIDG
NLLQEQMDRYKVVAAEDFDNLKLWLEECLEAHIPYIDTSFSSLNESIQYGLFDIKDKGFC
LKTIPNSKTLKEAEFYFPVKNENLYKTNILEILQEYRELTKLKTYSHSYVGGNLPTNYQD
LRDTRLREYGNLTNVSNQKIFGMLHGFIDLIFEYEGKFYVADYKSNYLGDTLEDYNQQAM
QEKNQSSFYDLQYLIYSVALDKYLRQNIESYNYEKHFGGVYYFYLRGMKDGYGVYRARPN
LEIINKLASLFNGDDNV
NT seq 3654 nt NT seq  +upstreamnt  +downstreamnt
atggacaacctaaacgcaaacataataactctacaaggtcgccatattatcgaggcaagt
gctggtactggtaagacttttaatattactaagttgtatatccgacttttgctagaaaaa
aaattattgccaagtaatatccttgtaatgacctttaccaaagatgcaacccaagagatt
attggtagagttgaaaaagagattcgagatgtattagcaagttatacagatgagaaaaag
gagtctgacaaagaaaactacaaacatctaaaaagatcattacttgagatagatgaggca
gctatatttactatccatggtttttgtaaaaaagtcttaagtgagcaagcctttgctagc
ggtatcgagatggatgtctctatggaggttgatacttcagatatttttcaaaaggttgta
gaggattttttcagaaaacatatcaataaaagcgaaactaattttggatatttacaaata
tataaattacatactccagagaaatttttagatgaccttgagaatattattaggtctaat
tatgagattttaacaaagcaagctataagcttagacgaatttaagatactcaaaaaacaa
cagttagaattatttattaataatcacgatatcgtagatgatttcttatataaattagga
aaaagtgagccacagggcaagagagtagatgagtatcatagggttttagaatggttgaaa
ttagataatcaaacactattcccagagaatatttctataattacagatggcagaaagata
agtgcaaaactaataaaaccaatttttattggcgtaaaagaattaagagacctgcaacaa
gaaataaaacaagcacaagcagcacaatttatcagaaaagcatgcttgcaaatccgccaa
gattttgcaaaggcaaaagatcaaaagggtgttttagactttgatgatttgattaccaag
ctttgccaaagtgtcaaaaaatcgccagagttagtcaaaactttgcaaaaacaatatcca
gttgctcttatagatgagtttcaagatactgatgctgagcagtatgagatattagatact
atttatcctttgaagaatagtagtagtcattcccacaaaggtaagaatctccttaccaat
ggattaaatttaaaagatacccgcttacgcgagtatgacagtagttctgatcagaacgat
agcaatcttctgctcttaatgataggcgatccaaaacaggcaatttatggctttagaggt
ggagatatcttcacatatctaaaagctaaagatagttgtccagaagaaaatcaatggagt
atggacaccaactggcgttcaactggagagatgataaaagcttataatagacttttttat
aaacaagattatcagtcagaagaagaggggcaaattggaactaatatttttagtgatggt
attggatatcagcttgtcaaagcttcaccggatgctgataaaaaaacaaaagattttgac
gataattttaaacctattaattatttctattatgaagtagccgaagatgataataaaagt
gatattgatacgaatttagcattatggacagtaaatgaaattactagattactaaataca
caaaaagtagcagaaaatgatatagctattttggtagaaaatggcaaacaggcaaagatt
atccaacaagctttgcaagctaaaaatctaagctcagtatacctaagccagcgcgataat
gtctatcacagtcaagaggctaaagagatcttagctcttatggagggtataaatgatctt
gaaaataaatctatgttgaaaagggcattatcgactagtttactcggtggtagagctgat
aagtttattagctatattgatgaaaatgatgtctcagcgtgggatgatgagatagaaaaa
gccaaatctctaaggcaacaatggcataaatatggatttatggcatttattatgcagatt
atacatgagaatttcactcaaaaagcagattcaaaagagcgtattattacaaatattctt
catttagcagaacttattaaagtggctgagaataaatataaacaccctaatcaactcatt
aaatggtatcgccaccaactcaacaatacagctacaagtgagggtgaacttagattagaa
agtgatgacaacttgattaagataattacaatccatggatcaaaaggacttgagtattca
gttgtgtttatcccgtttgcttgctatgcaagcacaaagaagtttgagacaagtaatttt
actaaatattatgatggtgacctaaaacaaactgtctacaaaattggcaaagatgatagt
gtgaaacagcaagctgataaagaggttatagaagaattaatgcgtctattttatgtagct
gttacgcgtgcagagcatagatgttatattggggttgcaaaatataataatagcgaaaag
tcaccattagcaagattcttaggttatcaaaaagatgatgattggttagagaagatccaa
agcataacagcaaatcctgctaatcaaagtctactgataaatattgcagatatgcgggaa
tttagtttaaaaaatttatctagcaaagataaaaattctgattatgatactctcaaagca
aattatattagtaaactagaaaatgatagttgggagatgttatctttctcaaaaatatca
aagtcaaaagttcaaaatactgcattagaaaaagaaattgacgaggcagaagatgataaa
actcaagcttcagacagaaagctagcatttagatttacagcttcaaaaggagctgatatg
ggtaatattctgcataatgttttagagcatacagattttagtttaggtgagatagatggt
aatcttttacaagaacaaatggatagatataaagtagttgctgcagaagacttcgataat
cttaaattatggttggaagaatgtttagaagcacatataccttatatagataccagtttt
tctagcttaaatgagagtattcaatatggtttatttgatatcaaggataaaggcttttgc
ttaaaaactatcccaaattcgaaaactctaaaagaggcggagttttattttcctgttaaa
aatgagaatttgtataaaacaaatatattagaaatcttgcaagagtatagagagcttaca
aaactgaagacatatagtcattcctacgtaggtgggaatcttccaactaactaccaagat
ctaagagatacccgcctccgcgagtatggcaatttaactaatgtttcgaatcaaaaaatt
tttggtatgcttcatggttttatagatcttatttttgagtatgagggtaaattttatgtt
gctgattataaatcaaattatctaggtgatactttagaagattataatcagcaggcgatg
caagagaaaaatcaaagtagcttttatgatttacagtatctaatatatagcgttgccttg
gataagtacctgcgacaaaacattgaaagttataattatgaaaagcattttggcggagta
tattatttttatcttagaggtatgaaagatggttatggagtttatcgagctagaccaaat
ttagagattatcaacaaacttgctagtttatttaatggagatgataatgtataa

DBGET integrated database retrieval system