KEGG   Francisella tularensis subsp. holarctica LVS: FTL_0915Help
Entry
FTL_0915          CDS       T00331                                 

Definition
(GenBank) acetolactate synthase, small subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
ftl  Francisella tularensis subsp. holarctica LVS
Pathway
ftl00290  Valine, leucine and isoleucine biosynthesis
ftl00650  Butanoate metabolism
ftl00660  C5-Branched dibasic acid metabolism
ftl00770  Pantothenate and CoA biosynthesis
ftl01100  Metabolic pathways
ftl01110  Biosynthesis of secondary metabolites
ftl01130  Biosynthesis of antibiotics
ftl01210  2-Oxocarboxylic acid metabolism
ftl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ftl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    FTL_0915
   00660 C5-Branched dibasic acid metabolism
    FTL_0915
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    FTL_0915
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    FTL_0915
Enzymes [BR:ftl01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     FTL_0915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACT_5 ACT ACT_4
Motif
Other DBs
NCBI-ProteinID: CAJ79354
Position
888117..888434
Genome map
AA seq 105 aa AA seqDB search
MSENIYFITMNTENTLCVLQRISSVLSRNRINIEQLTVFETANKGISHFNLVVHSTQDKI
EKIVRKLANVIEVIDISITNCLPMQGTVVSEVPQNVKTASQRKAA
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaatatatattttataacaatgaatactgaaaatactctttgtgttttacaa
agaatttcttctgttctttcacgtaatcgtataaatatagaacagttaacagtatttgaa
acggcaaacaaaggtatttctcatttcaatctagtggtacatagtacacaagataaaata
gaaaaaatcgtaagaaaattagcaaacgttatcgaagtgatagatattagtattacaaac
tgtttgccaatgcaaggaactgttgtaagtgaagttcctcaaaatgtcaaaacggcaagt
caaagaaaagcagcttaa

DBGET integrated database retrieval system