KEGG   Francisella tularensis subsp. holarctica LVS: FTL_1155
Entry
FTL_1155          CDS       T00331                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ftl  Francisella tularensis subsp. holarctica LVS
SSDB
Motif
Pfam: PliI PDZ_4
Other DBs
NCBI-ProteinID: CAJ79594
Position
1096796..1097197
AA seq 133 aa
MNENKNLLKDICYTVEKSGVTGIVVESTFSYSPELFKENQQDIKLNIKNMSVRVRDGKVK
RVTSIDRNANTEAILQSIYDNIIAFDEQDLERLFTGFRILKQENSTNTNKAVFNIGLTYH
PITNNAFVEFNKD
NT seq 402 nt   +upstreamnt  +downstreamnt
gtgaatgaaaataaaaatttgttgaaagatatttgctacactgtcgaaaaaagtggtgtt
acaggaatagtggttgaatcgacatttagctattcgccagaactcttcaaagaaaatcaa
caagatattaagcttaacattaaaaacatgtcagtcagagtacgagatggtaaagtcaag
agggttaccagcattgataggaatgctaatactgaagctatcttacaaagtatttatgat
aatataattgcgtttgatgaacaagatttagaaagactatttacggggtttaggatttta
aaacaagaaaattcgacaaacactaataaagccgttttcaatattggtttaacatatcat
ccaataactaataatgcttttgttgaatttaataaggattaa

DBGET integrated database retrieval system