KEGG   Francisella tularensis subsp. holarctica LVS: FTL_1156
Entry
FTL_1156          CDS       T00331                                 

Definition
(GenBank) hypothetical protein
Organism
ftl  Francisella tularensis subsp. holarctica LVS
SSDB
Other DBs
NCBI-ProteinID: CAJ79595
Position
1097207..1097410
AA seq 67 aa
MYSYNNLSKDAYVTKIKSIVDAKVALNLSFEHEEIRSSQGFSVLATVPARGYSIDDLNRK
YRPMIWV
NT seq 204 nt   +upstreamnt  +downstreamnt
ttgtactcatataataatttaagcaaagatgcgtatgtcacaaaaattaaaagtatagtt
gatgctaaagttgctttaaaccttagttttgaacatgaagagattagaagttcacaaggt
tttagtgtcttagcaactgtaccagctagaggatattctatagatgatttaaatagaaag
tatagaccaatgatctgggtttaa

DBGET integrated database retrieval system