KEGG   Francisella tularensis subsp. holarctica LVS: FTL_1168
Entry
FTL_1168          CDS       T00331                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ftl  Francisella tularensis subsp. holarctica LVS
SSDB
Motif
Pfam: Dynein_AAA_lid
Other DBs
NCBI-ProteinID: CAJ79607
Position
complement(1110648..1112312)
AA seq 554 aa
MNNNIDKWFENLFSNIHLYYKQEQSYKISKLNECITNVIKFINIKDYRKADIYNLTYVIE
DVRYSTNLILSDSAIKFNDLILKKLDNLLDCTDINYFTSLMKNLKVLLEKYKLVIEKDIS
NRIELIKTKQIDKLESIFLDYINNHSISAYDDSLVKLYVKTIQNPNSIEAIDEYKSYFDT
LKIFIKDHKNIVSFIPFRKNPILSLLKLAYLIRNGLYKTDRLLASDIILLRALYSINKDT
YKLSLINEKTDTNLSIVSLTSLQAKPSENLKKTIAFIDLQIFAISQYFDDFPLQDIFFQK
KSQIDIFKSESLEQLIFSLKNISNIMFDEETLYKKIHIKNQLYKNLFLNNHNSLIEDIIE
KSPANLLTKLANKYFQILLDIATIINIQLVNNNLKLIYPFLEFEKYFNQVTLEVSKKSQF
NQEKLEKNILNIIRIYPLLNQNYQLLKNMEQKIIDDKNSIESNDIYKLSVFVNSKSFSTY
KEIRTLTSNDHKDINIHKSLVKLNKNICNAKHKNAAETAKELTMVLLSKSYYMNPTLIGV
YNLPPISNSFFFGA
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgaataataatattgataaatggtttgagaatttatttagcaatatccatttatattat
aaacaagagcaatcttataaaataagtaagcttaatgagtgcatcactaacgtaatcaaa
tttataaatataaaagattatagaaaagctgacatctataatctgacctatgttattgaa
gatgtaagatactcaacgaatctaattttatctgactctgcaattaaatttaatgattta
atattaaaaaaattagataacctcttagattgtactgatattaactattttactagcctt
atgaagaatttaaaggttcttttagaaaagtataaactagtaatagagaaagatatatcg
aatagaatagaacttataaaaactaagcagatcgataaactagaatctatatttttagac
tatataaacaaccatagtatcagcgcttatgatgatagtcttgtaaaattatatgtaaaa
actatacaaaatcccaattccattgaggctatagatgagtataaatcatatttcgatacg
ctcaaaatatttataaaagatcataaaaatatagttagttttattccctttagaaaaaat
cctattttaagcttattgaaattagcttatttaattagaaatggtttatataaaacagat
cgtcttttagctagcgatattattcttttaagagctttatattctataaataaagataca
tataaattaagtcttataaatgaaaaaacagatactaacctatcaatagtttcgctgacg
tcactacaagctaagccctcagaaaacttaaaaaaaactattgcttttatagatttacag
atatttgctatatctcagtattttgatgatttccctttacaggatattttttttcaaaaa
aaatcacaaatagacattttcaagtcagaatcactagaacaacttattttcagtttaaaa
aatatttcaaatataatgtttgatgaagaaacactatataaaaaaatccatataaaaaat
caactctacaaaaacctttttttaaataatcacaatagtttgatagaagatattatagaa
aaatctccagcaaacttattaacaaagttagctaataaatacttccaaatactgctagac
atagcaacaataataaatattcaattagtaaataataatttaaagcttatttatcctttc
ttagagtttgaaaaatattttaatcaagtaactttagaagtatcaaaaaaatcacagttt
aatcaagaaaagctagaaaagaatattctaaatattatcaggatatatcctttactaaat
caaaactaccaattattaaagaatatggaacaaaaaattattgatgataaaaatagtata
gaatcaaacgatatatataagcttagtgtttttgtaaatagcaaaagtttttctacctat
aaagaaatcagaaccttaacctcaaatgaccataaagatattaacatacacaaatcttta
gtaaaactgaacaaaaatatttgtaatgccaaacataagaatgccgctgaaacagctaaa
gagctaacgatggttcttttaagtaaatcttactatatgaatccaactttgataggagta
tataatctaccgccaatttcaaatagttttttttttggtgcttaa

DBGET integrated database retrieval system