KEGG   Francisella tularensis subsp. holarctica LVS: FTL_1391Help
Entry
FTL_1391          CDS       T00331                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ftl  Francisella tularensis subsp. holarctica LVS
Pathway
ftl00230  Purine metabolism
ftl01100  Metabolic pathways
Module
ftl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ftl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    FTL_1391
Enzymes [BR:ftl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     FTL_1391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_23 AAA_33 AAA_22 MMR_HSR1 AAA_16 AAA_18 RsgA_GTPase ABC_tran DUF4921
Motif
Other DBs
NCBI-ProteinID: CAJ79830
UniProt: Q2A2K6
Position
complement(1320932..1321504)
Genome map
AA seq 190 aa AA seqDB search
MNNYIFIISAPSGAGKSSLLKAFLATDIGKDNYAVAISHTTREPRVGEINSREYYFVTVA
EFEQLLSQDGFIEYAKVFKNYYGTSKAELDRLLALGKNIILEIDWQGAQQTRAIYGDRAK
SIFILPPSLDELRKRLEKRNTDSKETIDYRMEQVQSEISHADEYDYLLVNDDFSQSLEQL
CKYFEQNIQS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaataactatatttttataatttctgcaccatctggcgcgggtaaaagttctttatta
aaagcttttttagcaactgacataggcaaggataactacgctgtagcaatctcccacact
actagagagccacgtgttggcgagatcaatagtagagaatattattttgtcacagtagct
gaatttgaacaattacttagtcaagatggctttattgaatatgctaaagttttcaaaaac
tattatggtacatctaaagctgagcttgatagattgcttgcattaggtaagaatattatc
cttgagattgactggcaaggtgcacaacaaacacgcgctatttatggcgatagggctaag
agtatatttatattaccgccttctttagatgagttaagaaaacgtctagaaaaaagaaat
acagattctaaggagactatagattatcgtatggagcaagtacaatcagagatttcacat
gctgatgaatatgattatctgctggttaacgatgattttagccagtcattagaacaatta
tgtaaatatttcgaacaaaatatccaaagttaa

DBGET integrated database retrieval system