KEGG   Francisella tularensis subsp. mediasiatica FSC147: FTM_0144Help
Entry
FTM_0144          CDS       T00698                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ftm  Francisella tularensis subsp. mediasiatica FSC147
Pathway
ftm00010  Glycolysis / Gluconeogenesis
ftm00051  Fructose and mannose metabolism
ftm00562  Inositol phosphate metabolism
ftm01100  Metabolic pathways
ftm01110  Biosynthesis of secondary metabolites
ftm01120  Microbial metabolism in diverse environments
ftm01130  Biosynthesis of antibiotics
ftm01200  Carbon metabolism
ftm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ftm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTM_0144 (tpiA)
   00051 Fructose and mannose metabolism
    FTM_0144 (tpiA)
   00562 Inositol phosphate metabolism
    FTM_0144 (tpiA)
Enzymes [BR:ftm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FTM_0144 (tpiA)
Exosome [BR:ftm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FTM_0144 (tpiA)
  Exosomal proteins of bladder cancer cells
   FTM_0144 (tpiA)
  Exosomal proteins of melanoma cells
   FTM_0144 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM PEP_hydrolase
Motif
Other DBs
NCBI-ProteinID: ACD30242
UniProt: B2SEZ7
Structure
PDB: 

Position
155257..156018
Genome map
AA seq 253 aa AA seqDB search
MQKLIMANWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPEKVGVG
LQNITFYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTIT
PVVCIGESLDDRQSGKLKQVLATQLSLILENLSVEQLAKVVIAYEPVWAIGTGVVASLEQ
IQETHQFIRSLLAKVDEKLAKNIKIVYGGSLKAENAKDILSLPNVDGGLIGGASLKAVEF
NEIINQANKICTE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattaataatggctaactggaaaatgaatggtaactctacaagcataaaagag
ctctgtagtggtatatcacaagtgcaatatgatacttcaagagtagctattgctgttttt
ccatcaagtgtttatgttaaagaagtaatctcacagctgccagagaaagtaggtgttggt
ctacaaaatattactttttatgatgatggtgcttatactggtgagatatctgctaggatg
ttggaagatattggttgtgactacttactaattggtcattctgagagaagatctctattt
gctgagtctgatgaagatgtttttaaaaagcttaacaagattatagatactactataacg
ccagtagtgtgtattggtgaatcactagatgatagacaaagtggtaagctcaaacaagtt
ttagcaacacaactaagcttaatcttagaaaatttatctgttgagcagttagcaaaagtc
gtaattgcatatgaacctgtctgggcaataggcacaggagttgtggcttcactagagcag
attcaagaaacacatcaatttattcgttcattgttagctaaagttgatgaaaaacttgct
aaaaatataaaaatagtgtacggtggtagcctaaaagctgaaaatgctaaagatatatta
agcttaccaaatgttgacggtggtttaattggtggcgcatctttgaaggctgttgaattt
aacgaaataataaatcaagcaaacaagatatgtacggaataa

DBGET integrated database retrieval system