KEGG   Francisella tularensis subsp. mediasiatica FSC147: FTM_1194Help
Entry
FTM_1194          CDS       T00698                                 

Gene name
hdc
Definition
(GenBank) histidine decarboxylase
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
ftm  Francisella tularensis subsp. mediasiatica FSC147
Pathway
ftm01100  Metabolic pathways
ftm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ftm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    FTM_1194 (hdc)
Enzymes [BR:ftm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     FTM_1194 (hdc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ACD31070
Position
1279278..1280414
Genome map
AA seq 378 aa AA seqDB search
MKNIEDLKLRLRHNKKVYVGYPTATDFDYDNCKELISEHFNNIGNPYSKGSPFSTLGHER
AVINFFLKLYMSNTNDSWGYIASCSSEAILYGVWNARNYFKAYDVTLVYSDYAHYCVSKT
ANILAIKNKVITSRNNGEIDLGSLESFLKENYNKNQAYIFIATIGSTITSSIDNYKEARN
IFKKYTDNFYIHLDGAFDGAFLPLKNDYILGEDFQSVNISGHKFLGNPMPSGILLIQKKY
ISQNYIEYIDNDDMTIGGSRNGLSAVLLYNRILSLGSKKGLIQRYQECLDKSETFLTILK
NNNIKAWKNPQAITIVLEDIDKRIFDKWHMPKYKNQATITCLPKLNKQMLMELIFDIKNP
DKIDFSNAKKFAEDISPL
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatattgaagatttaaaacttaggctaagacataataaaaaagtttatgtcggt
taccctaccgctacagattttgattatgataactgtaaagagctaatatctgagcatttt
aataatattggcaatccatatagtaaaggctctccttttagtactttaggtcacgaaaga
gctgttataaacttttttcttaagctatatatgtctaatacaaatgattcttggggatat
atagcaagctgcagttcagaagctatactttatggtgtttggaatgctagaaactacttt
aaggcttatgatgtaactttggtatatagtgattatgctcattattgcgtaagtaaaact
gcaaatatattagcaatcaaaaataaagttataacttctcgtaataatggagaaattgat
ttaggatcactagagagtttcttaaaagaaaattataataaaaatcaggcatatattttt
attgccacaattggctcaactataacatcctcaatagataattataaagaagctagaaat
atttttaaaaagtatacagataacttctatatacatctagatggtgcatttgatggtgct
tttctaccgctaaaaaacgattatattcttggagaagattttcaatcggtgaatattagt
ggacataaatttttaggtaatccgatgccttcaggaatattactaatacaaaaaaaatat
atttctcaaaactatatcgaatatattgataatgatgatatgacgataggaggcagcaga
aatggtttatcagcggtattgttatataatagaattttatctttaggatccaaaaaaggg
cttatacaaagatatcaagaatgtttagataaaagtgaaacctttctaacaatcctaaaa
aacaacaatataaaagcatggaaaaatcctcaagctattactatagtcctagaggacatt
gataaaagaatatttgataaatggcatatgcccaaatataaaaatcaagccacaataact
tgcctacctaagctaaacaaacaaatgcttatggaattaatttttgatataaaaaatcca
gataaaatagatttttctaatgctaaaaaatttgctgaagatattagccctctttga

DBGET integrated database retrieval system