KEGG   Francisella tularensis subsp. novicida U112: FTN_0001
Entry
FTN_0001          CDS       T00432                                 

Gene name
dnaA
Definition
(GenBank) chromosomal replication initiator protein
  KO
K02313  chromosomal replication initiator protein
Organism
ftn  Francisella tularensis subsp. novicida U112
Pathway
ftn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ftn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    FTN_0001 (dnaA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ftn03032]
    FTN_0001 (dnaA)
   03036 Chromosome and associated proteins [BR:ftn03036]
    FTN_0001 (dnaA)
DNA replication proteins [BR:ftn03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    FTN_0001 (dnaA)
Chromosome and associated proteins [BR:ftn03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    FTN_0001 (dnaA)
SSDB
Motif
Pfam: Bac_DnaA Bac_DnaA_C DnaA_N IstB_IS21 AAA_14 AAA ATPase_2 RNA_helicase AAA_22 AAA_24 AAA_19 AAA_16 AFG1_ATPase NB-ARC NACHT
Other DBs
NCBI-ProteinID: ABK88912
UniProt: A0Q3U7
Position
145..1620
AA seq 491 aa
MTTWDKCLKKIKKNLSTFEYKTWIKPIHVEQNSNLFTVYCNNEYFKKHIKSKYGNLILST
IQECHGNDLIIEYSNKKFSGKKITEVITAGPQANFFSTTSVEIKDESEDTKVVQEPKISK
KSNTKDFSSSQELFGFDEAMLITAKEDEEYSFGLPLKEKYVFDSFVVGDANKIARAAAMQ
VSINPGKLHNPLFIYGGSGLGKTHLMQAIGNHAREVNPNAKIIYTNSEQFIKDYVNSIRL
QDQDEFQRVYRSADILLIDDIQFIAGKEGTAQEFFHTFNALYENGKQIILTSDKYPNEIE
GLEERLVSRFGYGLTVSVDMPDLETRIAILLKKAHDLGQKLPNETAAFIAENVRTNVREL
EGALNRVLTTSKFNHKDPTIEVAQACLRDVIKIQEKKVKIDNIQKVVADFYRIRVKDLTS
NQRSRNIARPRQIAMSLARELTSHSLPEIGNAFGGRDHTTVMHAVKAITKLRQSNTSISD
DYELLLDKISR
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgactacatgggataaatgtttaaaaaaaataaaaaaaaacctttctacgtttgagtat
aagacgtggataaagcctatccatgtggagcaaaatagtaacttattcacagtttactgt
aacaatgaatatttcaaaaaacatataaaatctaagtatggaaatcttattttatcaaca
atccaagagtgtcatggtaatgatttaattattgaatattctaataaaaaattctctggc
aaaaaaattactgaggttatcacagctggaccacaagctaatttttttagcacaacaagt
gttgagataaaagatgaatcagaagatacaaaagtagtacaagaacctaagatatcaaag
aagtctaatactaaagacttttcttcatcacaagagttattcggttttgacgaagctatg
ctaattacagcaaaagaagatgaggaatactcttttggtttaccgttaaaagaaaaatat
gtttttgatagttttgttgttggagatgctaacaaaattgctagagcagcagctatgcag
gtatcgataaatccaggtaaattacataaccctttattcatttatggtggtagtggttta
ggtaaaactcacttaatgcaagcaataggtaatcatgcaagagaagttaatcctaatgcc
aaaattatttatacaaattcagaacaatttattaaagattatgtaaattctattcgttta
caagatcaagatgagtttcaaagagtttatagatctgcggatatacttttgattgatgat
attcaatttattgctggtaaagagggtactgctcaggagtttttccatacttttaatgca
ttgtatgaaaatggtaaacagataattctaactagtgataagtatccaaatgaaatagaa
ggacttgaagaaagactagtttcgcgttttggttatggtttgacagtttctgttgatatg
ccagatttagaaactagaattgctatcttgctcaaaaaagctcatgatttaggtcagaaa
ttacctaacgaaacagcagcttttattgctgagaatgtacgtactaatgtcagagagtta
gaaggtgctctaaatagggttcttactacctctaaatttaatcataaagatcctactatc
gaagtagcacaagcttgcttaagagatgttataaaaatacaagaaaagaaagtaaaaata
gataatatccaaaaggttgttgctgatttttatagaatcagggtaaaagatttaacttct
aatcaaagaagtagaaatatagctagaccaagacagatagcaatgagtttagcacgtgaa
ctaacatcacatagtttgccagaaataggcaatgcttttggtggtagagaccatacgaca
gttatgcatgctgtcaaagctataactaaattaagacaaagcaatacttcaatatcggat
gattatgagttgcttttagataaaatttctcgttaa

DBGET integrated database retrieval system