KEGG   Francisella tularensis subsp. novicida U112: FTN_0594Help
Entry
FTN_0594          CDS       T00432                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ftn  Francisella tularensis subsp. novicida U112
Pathway
ftn00020  Citrate cycle (TCA cycle)
ftn00640  Propanoate metabolism
ftn00660  C5-Branched dibasic acid metabolism
ftn01100  Metabolic pathways
ftn01110  Biosynthesis of secondary metabolites
ftn01120  Microbial metabolism in diverse environments
ftn01130  Biosynthesis of antibiotics
ftn01200  Carbon metabolism
Module
ftn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ftn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ftn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FTN_0594 (sucC)
   00640 Propanoate metabolism
    FTN_0594 (sucC)
   00660 C5-Branched dibasic acid metabolism
    FTN_0594 (sucC)
Enzymes [BR:ftn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     FTN_0594 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABK89489
UniProt: A0Q5H4
Position
complement(624492..625655)
Genome map
AA seq 387 aa AA seqDB search
MNLHEYQAKDLLESYGLKVQKGIVAHNPNEAAQAFDQLGGKFAVVKAQVHAGGRGKAGGV
KVVKSSQEAREVAESLIGKNLVTFQTDAEGQPVNSVGVFEDVYPVTRELYLGAVVDRSSR
KVTFMASTEGGVDIEEVAHNSPEKILKVEVDPLVGLQPFQAREVAFKLGLEGKQINDFVK
TMLGAYKAFIECDFALFEINPLAVRENGEIVCVDGKINLDSNALYRHPKLLALRDKSQEN
AKELKASEHELNYVALEGNIGCMVNGAGLAMATMDIIQLYGGKPANFLDVGGGATKERVI
EAFKLILDDENVKAVLINIFGGIVRCDMIAEAIIEAVKEVNVTVPVVVRLEGNNAEKGAK
ILADSGLKLIPADGLADAADKVVKSLG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaagctaaagatcttttagaaagctatggtctaaaagttcaa
aaaggtatcgtagctcataacccaaatgaagctgctcaagcatttgaccaattaggtggc
aaatttgctgtggttaaagctcaggtacatgctggtggtcgtggtaaagctggtggtgta
aaggttgttaaatcatctcaagaagctcgtgaagtagcagaaagcttaatcggtaaaaat
cttgttactttccaaactgatgctgaaggtcagccagttaattctgtaggtgtatttgaa
gatgtataccctgttactcgtgagttataccttggtgcggtagttgatagatctagccgt
aaagtaacattcatggcttcaactgaaggcggtgtagatattgaagaagttgcacacaac
tctcctgaaaaaatccttaaagtagaagtagatcctttagttggcttacaacctttccaa
gctcgtgaagtagctttcaagcttggtctagaaggcaagcaaatcaatgatttcgttaaa
actatgctaggtgcttacaaagcattcatcgaatgtgattttgccctatttgaaatcaac
cctcttgcagttagagaaaacggcgaaatcgtttgtgttgatggtaaaatcaaccttgat
tcaaatgctctttacagacaccctaaattattagctcttagagacaaatctcaagaaaat
gctaaagagcttaaagcttctgagcatgagctaaactatgtagctcttgaaggtaacatc
ggttgtatggtaaacggtgctggtctagcaatggctactatggatattatccaattatac
ggtggtaagcctgctaacttcctagatgtaggtggtggtgctactaaagaaagagtaatc
gaggctttcaaactaatcctagatgatgaaaatgtaaaagctgttttaattaacatcttc
ggtggtattgttcgttgtgatatgatcgctgaagcaattattgaagctgttaaagaagta
aatgtaactgtaccagtagttgttcgtctagaaggtaacaatgcagaaaaaggtgctaaa
atattagctgattcaggtttaaaactaatacctgctgatggtttagctgatgctgctgat
aaagttgtgaaatcactaggttaa

DBGET integrated database retrieval system