KEGG   Francisella tularensis subsp. novicida U112: FTN_0806Help
Entry
FTN_0806          CDS       T00432                                 

Definition
(GenBank) glycosyl hydrolase family 3
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ftn  Francisella tularensis subsp. novicida U112
Pathway
ftn00520  Amino sugar and nucleotide sugar metabolism
ftn01100  Metabolic pathways
ftn01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ftn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FTN_0806
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    FTN_0806
Enzymes [BR:ftn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     FTN_0806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 TPP_enzyme_M CheF-arch
Motif
Other DBs
NCBI-ProteinID: ABK89694
UniProt: A0Q629
Position
complement(862720..864387)
Genome map
AA seq 555 aa AA seqDB search
MSTNSNIRQKLGQLIMMDFRYWGEDSNNQRIPFTKTNDIVDKIFKYYNLGGFILFRENIQ
NNEQVISLLRDLQANTNTPIFFATDQEGGRVNRLQQGTSGCGNMALAATDNPHNAYTMAK
IIGDELYSLGININFAPAIDVNSNKNNPIIGVRSYSDNPNVVTDYAKNAINGYHDAKIID
CIKHFPGHGDTATDSHLGNVILDKTLKELQTTELLPFSKLARDCSMIMTAHISVPALDDS
QYISVSTSENIYVPATLSYKIITKLLKQQMKFDGLVVSDAMDMHAIAKHFGTIEASKLAI
LAGIDILLMPVRVWSENDLYKLEELFCELEKEYNQNSNFANAVDNAYTNITDFKAKHKLD
ESLIFKLSQDEQLKYANQIVNSNKHQQIALDIAKQSTTVVKNSGIIPCDLNKLKNILIVD
SDNQRLADFHSELQKIVLDNNSNVIINCENINNYNIKTIIENADLILLISANLREYNQTY
SYITSIKPEQTINIAALTPYDINYIDNIVNYVCIYGATSMDQTNYTKTSLKINIQAALEN
ILGNKEIRGVLPVSL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaaactcaaatataagacaaaaactaggtcaactaattatgatggatttccgc
tattggggtgaagattcaaataatcagcgtataccttttacaaaaactaatgatatcgtc
gataagatctttaaatactataatttaggtggttttatcctttttagagagaatattcaa
aataatgagcaagttatctctctattaagagatcttcaagctaacaccaatacaccaata
tttttcgctacagatcaagaaggtggcagagttaatcgcttacaacaaggtactagtggc
tgcggaaacatggcattagctgcaacagataatcctcataatgcctatactatggctaaa
ataattggcgatgaattatattctttaggtatcaatattaattttgctccagctatagat
gtcaactctaacaaaaacaatccaattattggtgtaaggtcttactcagataatcccaat
gtagttactgactatgccaaaaatgctataaatggttatcatgatgctaaaatcatagac
tgcattaagcacttccctggccatggtgatactgcaacagatagtcatttaggcaatgta
atcttagataaaactttgaaagaattacagacaacagagctactaccctttagtaaactt
gctagagattgtagtatgataatgacagcacatattagtgttccagccttagatgatagt
cagtatatatcagtctcaacaagtgagaatatttatgtgccagctaccctctcttataaa
ataataactaaattactaaaacaacaaatgaaatttgatggtttagtagtatctgatgcc
atggacatgcatgctattgctaaacactttggaactattgaggcttctaaattagctatc
ttagctggtatagatattttattgatgcctgttcgagtatggtcagaaaatgatctttat
aaattagaagagcttttttgtgaactagaaaaagaatataatcaaaattctaattttgct
aatgcagttgataatgcctatacgaatattactgatttcaaagcaaaacataaactcgat
gaaagtttaatattcaagctctcacaagatgagcaattaaaatatgctaatcaaatagtt
aactctaataaacatcaacaaatagctttagatattgctaaacaaagtacaactgtagtt
aaaaattcaggtattattccatgcgatctcaataagctaaaaaatatcttgattgtagat
agtgataaccaacgcttagcggattttcatagcgagttgcagaaaatagtgttagacaat
aactcaaatgttattattaactgcgaaaatattaataactataatattaaaactattatc
gaaaatgccgatctgatcctattaatttcagcgaatcttcgtgaatataatcagacctat
agttatataacttctataaagccagagcaaactataaatatagcagcacttactccttat
gatattaattatatagataatattgtcaattatgtttgtatttatggtgcgacttctatg
gatcaaacaaactatacaaagacttcactaaaaattaatattcaagcagcattagaaaat
attcttggtaataaagagattagaggagtactaccagtcagtttataa

DBGET integrated database retrieval system