KEGG   Francisella tularensis subsp. novicida U112: FTN_0810Help
Entry
FTN_0810          CDS       T00432                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ftn  Francisella tularensis subsp. novicida U112
Pathway
ftn00010  Glycolysis / Gluconeogenesis
ftn00052  Galactose metabolism
ftn00500  Starch and sucrose metabolism
ftn00520  Amino sugar and nucleotide sugar metabolism
ftn00521  Streptomycin biosynthesis
ftn01100  Metabolic pathways
ftn01110  Biosynthesis of secondary metabolites
ftn01120  Microbial metabolism in diverse environments
ftn01130  Biosynthesis of antibiotics
ftn01200  Carbon metabolism
Module
ftn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ftn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTN_0810
   00052 Galactose metabolism
    FTN_0810
   00500 Starch and sucrose metabolism
    FTN_0810
   00520 Amino sugar and nucleotide sugar metabolism
    FTN_0810
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FTN_0810
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    FTN_0810
Enzymes [BR:ftn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FTN_0810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK IF2_N
Motif
Other DBs
NCBI-ProteinID: ABK89698
UniProt: A0Q633
Position
867532..868416
Genome map
AA seq 294 aa AA seqDB search
MSKEIRIKNRTVVGVDIGGTKVNAGRVCGENLLASYLSKIPRDAEHNAQSVIDVVINTIA
KVFTSEVEGIGVGIPSVADREKGIVYDVQNIKSWQEIHLKEILETEFKVPVFIDNDANCF
AIGQRLYGKGKEHENFVGITIGTGIGGGIINKGSLLKDSNCGAGEFGMLPYLDGILEDYC
SGQFFIKKIGVEGVEILKRARNNDKDAINIYKQFGKHLGVAIKSIMYTLDPEVIIIAGSI
ISAREFFEKAMWDEIKTFAFTQSAKKIKIEWSETEGDFQVFGAAAVYLDRSSNL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagaaattcgaattaagaatagaactgtggttggtgttgatatcggtggcact
aaagtgaatgctggtagggtatgtggagaaaatctattagcctcttacttgagcaaaatt
ccacgagatgcagaacataatgctcaatctgttattgatgttgtcataaatactatagca
aaagttttcacttctgaagtagaaggtattggcgttgggattcctagtgttgcagatcga
gaaaagggaattgtatatgatgtgcaaaatatcaaatcatggcaagagatccatctaaaa
gaaatacttgaaacagagtttaaagtaccagtttttatagataatgatgctaattgtttt
gctataggtcaaagactatatggcaagggcaaagagcatgaaaatttcgttggtattaca
ataggcacgggtattggtggtggtattatcaataaaggctccttactaaaagactctaat
tgcggtgctggagaatttggcatgttgccatatctagatggaattttagaagattattgt
agtggtcaattttttataaaaaagattggtgttgaaggtgttgagattctcaagcgtgca
agaaataatgataaagatgctataaatatctataaacaatttggtaaacatcttggagta
gcaataaagtctattatgtatactctagacccagaagtgataataatcgcagggtcaata
atctcagctagagagttttttgaaaaagcaatgtgggatgagattaaaacatttgccttt
actcaatcagctaaaaaaattaaaatagaatggtcagaaacggaaggagattttcaggtt
tttggcgctgcagctgtttatttggatagaagtagcaatttataa

DBGET integrated database retrieval system