KEGG   Francisella tularensis subsp. novicida U112: FTN_1284
Entry
FTN_1284          CDS       T00432                                 

Symbol
dnaK
Name
(GenBank) chaperone, heat shock protein, HSP 70 family
  KO
K04043  molecular chaperone DnaK
Organism
ftn  Francisella tularensis subsp. novicida U112
Pathway
ftn03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ftn00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    FTN_1284 (dnaK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ftn03019]
    FTN_1284 (dnaK)
   03110 Chaperones and folding catalysts [BR:ftn03110]
    FTN_1284 (dnaK)
   03029 Mitochondrial biogenesis [BR:ftn03029]
    FTN_1284 (dnaK)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ftn04147]
    FTN_1284 (dnaK)
Messenger RNA biogenesis [BR:ftn03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     FTN_1284 (dnaK)
Chaperones and folding catalysts [BR:ftn03110]
 Heat shock proteins
  HSP70 / DNAK
   FTN_1284 (dnaK)
Mitochondrial biogenesis [BR:ftn03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    FTN_1284 (dnaK)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    FTN_1284 (dnaK)
Exosome [BR:ftn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   FTN_1284 (dnaK)
  Exosomal proteins of breast cancer cells
   FTN_1284 (dnaK)
  Exosomal proteins of colorectal cancer cells
   FTN_1284 (dnaK)
SSDB
Motif
Pfam: HSP70 MreB_Mbl CATASP FGGY_C RNA_pol_Rpb2_2 DUF1090 PMI_typeI_hel
Other DBs
NCBI-ProteinID: ABK90165
UniProt: A0Q7F0
Position
complement(1356202..1358130)
AA seq 642 aa
MGKIIGIDLGTTNSCLAIMDGKTAKVIENAEGHRTTPSVVAYTDSGEILVGQAAKRQAVT
NPDNTFFAIKRLIGRKYDDKAVQEDIKKKVPYAVIKADNGDAWVATKEGKKMAPPQVSAE
VLRKMKKTAEDYLGEPVTEAVITVPAYFNDSQRQATKDAGKIAGLEVKRIINEPTAAALA
YGVDSKKGEQTVAVYDLGGGTFDISIIEIADVDGDNQIEVLSTNGDTFLGGEDFDLALMN
YLIDEFKKEQGIDLHNDKLALQRVREAAEKAKVELSSAQQTDVNLPYITADATGPKHLNI
KVTRAKFESLVSDLVMRSLEPCKKALEDAGLSKSDITEVLLVGGQTRMPLVQEKVKEFFG
KEPRKDVNPDEAVAVGAAIQGGVLAGDVKDVLLLDVTPLSLGIETMGGVMTKLIERNTTI
PTKKSQVFSTAEDNQPAVTIHVLQGEREMASANKSLGRFDLADIPPAPRGMPQIEVTFDI
DANGILNVSAKDKATGKEQNIVIKSSSGLSEEDIEKMVQDAEANAEADKKFHDLVTARNT
ADNLIHSSRKAIQELGDKVTAAEKEKIEEACKELEAATKSDDKQAIEAKTKALEEAFAPI
AQKAYAEQAQAAGAQGGAKAEEPKKEEDVVDADFEDVEDDKK
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgggaaaaataataggtatagatttaggtactactaactcttgtcttgctattatggat
ggcaagactgctaaagttattgagaatgctgaaggacatagaacaacaccttcagtagtt
gcgtatactgatagcggtgaaatattagtaggtcaagctgctaaaagacaggctgtaact
aaccctgataatacattctttgctatcaagagacttataggtcgtaagtacgatgataaa
gctgtacaagaagatattaaaaagaaagtaccttatgcggtaattaaagctgataatggt
gatgcttgggttgctactaaagaaggcaaaaaaatggctccaccgcaagtttctgcagaa
gttctaagaaaaatgaaaaaaactgcagaagactatctaggtgaaccagttacagaagct
gtaattacagtgccagcatacttcaatgatagtcaaagacaagctacaaaagatgctggt
aaaattgcaggtcttgaagttaaaagaatcatcaacgagcctacagcagcagcgctggca
tatggtgtagactctaagaaaggtgagcaaactgtagcggtgtatgacctaggtggtggt
acattcgatatctcaattattgagattgctgatgttgatggcgataaccaaatcgaagta
ttatcaaccaatggtgatactttcttaggcggtgaagacttcgacttggctttaatgaac
tatctaattgacgagttcaaaaaagagcaaggtatagatcttcacaatgataagcttgct
ttacaaagagttagagaggctgctgagaaagctaaagtagaattatcttcagcacaacaa
actgatgttaacttaccttacatcacagcagatgctactgggcctaagcacttaaatatc
aaagtgactagagctaagtttgagtctttagtttctgatcttgtaatgagatcacttgag
ccttgtaagaaagctcttgaagatgctggtttaagtaagtctgatattacagaagtatta
ctagtgggtggacaaactcgtatgcctctagtacaagagaaagtaaaagagttttttggt
aaagagccacgtaaagatgtgaaccctgatgaagctgttgcagttggtgcggctattcaa
ggtggtgtattagcaggtgatgttaaagatgttcttttattggatgtaacaccgctttct
ctaggtattgagactatgggaggtgttatgactaagcttatcgagagaaatactacgatt
cctactaagaagtcgcaagtattctcaacagctgaagataaccagcctgcggtaactatt
catgtacttcaaggtgagcgtgaaatggcttctgcaaacaaatctttaggtagatttgat
ctggcagatattccaccagcgccacgtggtatgccacaaattgaggttacttttgatata
gatgctaacggtatattaaatgtgtctgctaaagataaagctactggtaaagagcaaaat
attgtgattaagtcttcaagtggtttatctgaagaggatatcgaaaaaatggtacaagac
gctgaagctaatgcagaagcagataaaaagttccatgatttagttactgctagaaatact
gctgataacttaattcatagctcaagaaaagcaattcaagaactaggtgacaaagtaaca
gcagcagaaaaagaaaaaatcgaagaagcttgtaaagagcttgaagcagcaactaaaagt
gatgataagcaagcgattgaagccaaaactaaggctctagaagaagcatttgcgccaata
gctcaaaaagcttatgctgagcaagctcaagctgctggtgcccaaggtggtgctaaagct
gaagaacctaagaaagaagaagatgttgttgatgctgactttgaggatgttgaagacgac
aaaaaataa

DBGET integrated database retrieval system