KEGG   Francisella tularensis subsp. novicida U112: FTN_1322
Entry
FTN_1322          CDS       T00432                                 

Gene name
iglC
Definition
(GenBank) intracellular growth locus protein C
Organism
ftn  Francisella tularensis subsp. novicida U112
SSDB
Motif
Pfam: IglC
Other DBs
NCBI-ProteinID: ABK90198
UniProt: A0Q7I3
Structure
PDB: 
2QWU

Position
complement(1396989..1397618)
AA seq 209 aa
MSEMITRQQVTSGETIHVRTDPTACIGSHPNCRLFIDSLTIAGEKLDKNIVAIEGGEDVT
KADSATAAASVIRLSITPGSINPTISITLGVLIKSNVRTKIEEKVSSILQASATDMKIKL
GNSNKKQEYKTDEAWGIMIDLSNLELYPISAKAFSISIEPTELMGVSKDGMSYHIISIDG
LTTSQGSLPVCCAASTDKGVAKIGYIAAA
NT seq 630 nt   +upstreamnt  +downstreamnt
atgagtgagatgataacaagacaacaggtaacaagtggcgagaccattcatgtgagaact
gatcctactgcatgtataggatctcatcctaattgtagattatttattgattctttaact
atagctggggagaaacttgataaaaatatcgttgctatagagggtggagaggatgtcacg
aaagctgattcggctacagctgctgctagtgtaatacgtttatctataacgccaggctct
ataaatccaacaataagtattactcttggtgttctaattaaatcaaatgtcagaactaaa
attgaagagaaagtttcgagcatattacaagcaagtgctacagatatgaaaattaagtta
ggtaattctaataaaaaacaagagtacaaaactgatgaagcatggggtattatgatagat
ctatctaatttagagttatatccaataagtgctaaggcttttagtattagtatagagcca
acagaacttatgggtgtttcaaaagatggaatgagttatcatattatatctatagatggt
cttacaacatctcaaggaagcttgccagtatgttgcgcagctagcacagataaaggagtt
gctaaaataggatatattgcagctgcatag

DBGET integrated database retrieval system