KEGG   Francisella tularensis subsp. novicida U112: FTN_1325
Entry
FTN_1325          CDS       T00432                                 

Gene name
pdpD
Definition
(GenBank) protein of unknown function
Organism
ftn  Francisella tularensis subsp. novicida U112
SSDB
Other DBs
NCBI-ProteinID: ABK90201
UniProt: A0Q7I6
Position
complement(1399803..1403540)
AA seq 1245 aa
MDQDINDLLYDTDDLKKEKVNGGFFDFIKAWFYNDVERHMFFEDEIIVAQKLKTMDVMAN
TYALERKKYFEKFLKDSHKQKGFFTRIKDRDFAFYKDPTRVKLWSSITDTDVYSFFIKSS
VNQMLGGGNIAQLTSLPKFKFNAIASVNSENISAAASLAATGEKSFLGSSCINVWSNLPV
FDSERGDVKSFIPLYLRMSGKASSALFNYNIDIGASTNKLKFTESKCMELLNNFKGNVNL
RLVAAKSSREARSFIYTPKFKEDSNKHLNDLGFILNAQQGSYRYLVPETRDGLDLIREYT
YPEIEQIYFGRSALSGYSKSNYDKQSLGIEKNGEGLMTLRVSSKDYENPLIQVKTSVNVT
SFDLLSGEIKGKILADDLIGFSDAKGAINKFRNEVDTIIKNNISESFKSPFKIPNLSEFS
DMEIRVRFGLYSKQSASKLRTIRISIPMTTKMLDFNQTSGSYNTKPGMGYSMAQRHQLKE
AIPYNEGLLENSAQRLFSGENLDFKNQLRSIAKDLTKDYVDFGNYAKDKANSLMENISNA
AQQDFDLVKPTGNSTLGAVQDNLSNIYDKSSTFDSVIGSLRELYKLKGEDLTNIDSNDIL
NVLSQNSSLAELSGSVGADLNELKSKFKDIASIDIKKKASEAILSTSYQQYNPSFNKAKI
FDNPDSFYVQDTLINYSQTLKKEQFRDQMSTINIIEFGSDSDLPILFNLCKMMTSESAKA
DAKDFLSHKENASKTKEFIDALENTTSVISPESNISYTSINVLCSKNAGGVITENNKASS
VSLGSTISLADFNRMYSLDSRVSMLGVSPLEELSSFSAKKNEYKITFEEYFTKLVIQRYM
EVIMIDDEADFIKSFVSPMMECQKKLLDNLVILNKDAKWKSSSSFKSTFSSGSSFSFTGW
LKERLPGFDFELSQEYAYFTGLVINFSIEEDNSSSETVIKLCKIIKSLDGLVRGFYFLLR
RMVKNRNTKVGSHNVSESHINMVKQILTSLCEPYQILTQKVSDNAELLSALVNMLSFMDS
LVEVQRLCASICIPTSAFFTLVNENKNLLKDICYTVEKSGVTGIVVESTFSYSPELFKEN
QQDIKLNIKNTSVRVRNGKVKRVSSIDRNANTEAILQSIYDNIIAFDEQDLERLFTGFRI
LKQENSTNTNKAVFNIGLTYHPITNNAFVEFNKDQQSLLYSYNNLSKDAYVTKIKSIVDA
KVALNLSFEHEEIRSSQGFSVLATVPARGYSIDDLNRKYRPMIWV
NT seq 3738 nt   +upstreamnt  +downstreamnt
atggatcaagatatcaacgatttattatatgatactgatgacctcaaaaaagaaaaagta
aatggaggattttttgattttatcaaagcttggttttataatgacgttgaaagacatatg
ttttttgaagatgagattattgtagctcagaaacttaaaacgatggatgtcatggctaat
acatacgccttagaaagaaaaaaatattttgaaaaatttctcaaagattctcataaacaa
aaaggtttttttacaagaataaaagatagggattttgctttttataaagatcctactagg
gttaaactatggagtagtattactgatacggatgtttatagcttttttataaagtcaagc
gttaatcagatgcttggtggtggtaatatagctcaactgacatcattgccaaaatttaag
tttaatgcaatagcatcagttaatagtgaaaacatctctgcagcagctagtcttgcagct
actggagaaaaaagttttttgggaagttcatgtataaatgtttggtctaatttacctgta
tttgatagtgaaagaggagatgttaaatcatttattccattatacctaagaatgagtggt
aaagcttcatcggcattatttaattataatatagatataggtgctagcacaaataaatta
aaatttactgaatcaaaatgcatggaattgttaaataactttaagggtaatgtaaatctt
agattagtagctgcaaaaagctctagagaagcaagaagctttatttatactccaaaattt
aaagaagatagtaataagcatttaaatgatttaggttttattctaaatgctcagcaaggt
tcatatagatatttagttcctgaaactagggatggacttgatctaattagagaatataca
taccccgaaattgaacagatttattttggtaggagtgcactttctggttattcaaaaagt
aattatgacaagcaaagtttaggtattgagaaaaatggtgagggtcttatgactcttagg
gttagttccaaagattatgaaaatccactaattcaggtcaaaacttcagttaatgtaact
agttttgatcttttatcaggagaaataaaaggtaagattttagctgatgacttaattggt
ttttcagatgctaaaggtgctattaataagttcagaaacgaagttgatacaattattaaa
aacaatattagtgaaagctttaagtctccttttaagataccaaacttatctgaatttagt
gatatggagataagagtgaggtttggtttatattctaaacaatcagcatccaagttgagg
accataagaatctctattcctatgactactaaaatgttagattttaatcaaacatctggg
tcatataatacaaaaccaggtatgggttattcaatggctcagagacatcaattaaaagaa
gcaataccttataatgaaggtcttctagaaaattctgctcagagattgtttagtggtgaa
aacttagattttaaaaaccagttgagatctatagctaaagatctgacgaaagattatgtc
gattttggtaattatgcaaaagataaggctaactctttgatggagaatatttcaaatgct
gctcagcaggattttgatttggttaaaccaaccggaaatagtactcttggagctgtgcaa
gataatttatcaaacatatatgataaaagtagtacgtttgactcagtaataggttctttg
agagagctttataaacttaaaggtgaagacctaacgaatattgattctaatgatatcctt
aatgttttatcacaaaattcttctttagcagagttatctggtagtgttggggcagatcta
aatgagctaaagtctaagtttaaggatatcgcatctatagatataaagaaaaaagcatct
gaagcaatattatctacaagttatcagcaatataaccctagttttaataaggcaaaaata
ttcgataacccagattctttctatgttcaagatactttaattaactactcacaaactcta
aaaaaagaacaatttagagatcagatgtcgacaataaatattattgagtttggtagtgat
agtgacttacctatattatttaatctttgtaaaatgatgactagtgagtcagcaaaagct
gatgctaaagattttctaagccacaaggaaaatgctagtaaaactaaagaatttattgat
gctttagaaaataccacttctgtaataagtccagaatcaaatatcagttatacatctatt
aatgtgctttgtagcaaaaatgctggaggtgtaattactgagaataacaaagcatcttct
gtatccctaggttcaactattagtttagcggattttaatagaatgtattcgcttgactca
agagtttctatgcttggagtatctcctttagaagagttatcaagtttttcagcgaaaaaa
aatgaatataaaatcacttttgaagaatattttactaagttagtgattcaaagatatatg
gaagttattatgatagatgatgaagctgactttataaaatcatttgtatcaccaatgatg
gagtgtcaaaagaaactattagataatttagttattctaaataaggatgctaaatggaaa
agtagttcatcatttaagagcactttctcaagtggtagtagttttagttttactggttgg
cttaaagagagacttcctggctttgattttgaactttctcaggagtatgcttattttact
ggtttagtaataaacttttcaattgaagaagataattcttcttctgaaaccgtaattaag
ctatgtaaaattataaaatctttagatgggcttgttagaggtttttatttcttactaaga
aggatggtgaaaaatagaaatactaaagttggttctcataatgtctctgaaagtcacatt
aatatggttaagcagattttaacatccttatgtgaaccatatcagattttaactcagaag
gtaagcgataatgctgaactgttgtctgctttagttaatatgttgagttttatggatagc
cttgttgaagtacagcggttatgtgcttcgatttgtattccaaccagtgcatttttcact
ttagtgaatgaaaataaaaatttgttgaaagatatttgctacactgtcgaaaaaagtggt
gttacaggaatagtggttgaatcgacatttagctattcgccagaactcttcaaagaaaat
caacaagatattaagcttaacattaaaaacacgtcagtcagagtacgaaatggtaaagtc
aagagggttagcagcattgataggaatgctaatactgaagctatcttacaaagtatttat
gataatataattgcgtttgatgaacaagatttagaaagactatttacggggtttaggatt
ttaaaacaagaaaattcgacaaacactaataaagccgttttcaatattggtttaacatat
catccaataactaataatgcttttgttgaatttaataaggatcaacaaagtttattgtac
tcatataataatttaagcaaagatgcgtatgtcacaaaaattaaaagtatagttgatgct
aaagttgctttaaaccttagttttgaacatgaagagattagaagttcacaaggttttagt
gtcttagcaactgtaccagctagaggatattctatagatgatttaaatagaaagtataga
ccaatgatctgggtttaa

DBGET integrated database retrieval system