KEGG   Francisella tularensis subsp. novicida U112: FTN_1357Help
Entry
FTN_1357          CDS       T00432                                 

Gene name
recB
Definition
(GenBank) ATP-dependent exoDNAse (exonuclease V) beta subunit
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
ftn  Francisella tularensis subsp. novicida U112
Pathway
ftn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ftn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    FTN_1357 (recB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ftn03400]
    FTN_1357 (recB)
Enzymes [BR:ftn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     FTN_1357 (recB)
DNA repair and recombination proteins [BR:ftn03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     FTN_1357 (recB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 AAA_30 Lys Helicase_RecD Cucumo_coat SBDS_C
Motif
Other DBs
NCBI-ProteinID: ABK90232
UniProt: A0Q7L7
Position
complement(1435324..1438974)
Genome map
AA seq 1216 aa AA seqDB search
MKNLNANTITLQGRHIIEASAGTGKTFNITKLYIRLLLEKKLLPSNILVMTFTKDATQEI
IGRVEKEIRDVLASYTDEKKESDKENYKHLKRSLLEIDEAAIFTIHGFCKKVLSEQAFAS
GMEMDVSMEVDTSDILQKVVEDFFRKHINKSETNFEHLQAYKLHTPDMFLDKLRNVVRSS
HELLTKQAISLDEFKILKKQQLELFINNHDIVDDFLSKLGKGEPQGKRVDEYHRVLEWLK
LDNQTLFPENISIITDGRKISAKLIKPIFIGVKELRDLQQEIKQAQAAQFIRKACLQIRE
SFAKAKEQKGVLDFDDLITKLCQSVKKSPDLVKTLQKQYPVALIDEFQDTDAEQYEILDT
IYPLKNSSHSHEGGNLLTNGLNLKDTRLREYDSSSDQNDSNLLLLMIGDPKQAIYGFRGG
DIFTYLKAKDSCPEENRWSMDTNWRSTGEMIKAYNRLFYKQDYQPEEEGQIGTNIFSDGI
GYQLVKASPDADKKTKDFDDNFKPINYFYYEVAEDDNKSDIDTNLSLWTVNEITRLLNTQ
KVAENDIAILVENGKQAKIIQQALQAKNLSSVYLSQRDNVYHSQEAKEILALMEGINDLE
NKSMLKRALSTSLLGGRADKFISYIDENDVSAWDDEIEKAKSLRQQWHKYGFMAFIMQII
HENFTQRADSKERIITNILHLAELIKVAENKYKHPNQLIKWYRHQLNNTATSEGELRLES
DDNLIKIITIHGSKGLEYSVVFIPFACYASTKKFETSNFTKYYDSDLKQTVYKIGKDDSV
KQQADKEVIEELMRLFYVAVTRAKHRCYIGVAKYNNSEKSPLARFLGYQKDDDWLEKIQS
ITANPANQSLLINIADMREFSLKNLSSKDKNSDYDTLKANYISKLENDSWEMLSFSKISK
SKVQNTALEKEIDEAEDDKTQASDRKLAFRFTASKGADMGNILHNVLEHTDFSLGEIDGN
LLKEQMDRYKVVAAEDFDNLKLWLEECLEAHIPYIDTSFSSSNESIQYGLFDIKDKGFCL
KTIPNSKTLKEAEFYFPVKNENLYKTNILEILQEYRELTKLKTYSHSYVGGNLSTNYQDL
RDICLREYDNFTNFSNQKIFGMLHGFIDLIFEYEGKFYVADYKSNYLGDTLEDYNQQAMQ
EKNQSSFYDLQYLIYSVALDKYLRQNIESYNYEKHFGGVYYFYLRGMKDGYGVYQARPTL
EIINKLASLFNGDDNV
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacctaaacgcaaacacaataaccctacaaggtcgccatattatcgaggcaagt
gctggtactggtaagacttttaatattactaagttatatatccgacttttgctagaaaaa
aaattattgccaagtaatatccttgtaatgacctttaccaaagatgcaacccaagagatt
atcggtagagttgaaaaagagattcgagatgtattagcaagttatacagatgagaaaaag
gagtctgacaaagaaaactacaaacatctaaaaagatcattacttgagatagatgaagcc
gcaatttttactatccatggtttttgtaaaaaggttttgagcgagcaagcctttgctagt
ggtatggagatggatgtctctatggaggttgatacttcagatattttgcaaaaggtagta
gaggattttttcagaaaacatatcaataaaagcgaaaccaattttgaacatttgcaagca
tataagctacatactccagatatgtttttggataagctaagaaatgttgttaggtctagt
catgaacttttaacaaagcaagctataagcttagacgaatttaagatactcaaaaaacaa
cagttagaattatttattaataatcacgatatcgtagatgatttcttatctaaattagga
aaaggtgagccacagggcaagagagtagatgagtatcatagggttttagaatggttgaaa
ttagataatcaaacactattcccagagaatatttctataattacagatggcagaaagata
agtgcaaaactaataaaaccaatttttattggcgtaaaagaattaagagacctacaacaa
gaaataaaacaagcacaagcagcacaatttatcagaaaagcatgcttgcaaatccgtgaa
agttttgcaaaagctaaagaacaaaagggtgttttagattttgatgatttgattactaaa
ctttgccaaagtgtcaaaaagtcgccagatttagtcaaaacattgcaaaaacaatatcca
gttgctcttatagatgagtttcaagataccgatgctgagcagtatgagatattagatact
atttatcctttgaagaatagtagtcattcccacgaaggtggaaatctccttaccaatgga
ttaaatttaaaagatacccgcttacgcgagtatgacagtagttctgatcagaacgatagc
aatcttctgctcttaatgataggcgatccaaagcaggcaatttatggctttagaggcgga
gatatcttcacatatctaaaagctaaagatagttgtccagaagaaaatcgatggagtatg
gacaccaactggcgttcaactggagagatgataaaagcttataatagacttttttataaa
caagattatcagccagaagaagaggggcaaattggaactaatatttttagtgatggtatt
ggctatcagcttgtcaaagcttcaccggatgctgataaaaaaacaaaagattttgacgat
aattttaaacctattaattatttctattatgaagtagccgaagatgataataaaagtgat
attgatacgaatttatcattatggacagtaaatgaaattactagattactaaatacacaa
aaagtagcagaaaatgatatagctattttggtagaaaatggcaaacaggcaaagattatc
caacaagctttgcaagctaaaaatctaagctcagtatacctaagccagcgcgataatgtc
tatcacagtcaagaggctaaagagatcttagctcttatggagggtataaatgatcttgaa
aataaatctatgttgaaaagggcattatcgactagtttactcggtggtagagccgataag
tttattagctatattgatgaaaatgatgtctcagcgtgggatgatgagatagaaaaagct
aaatctctaaggcaacaatggcataaatatggatttatggcatttattatgcagataata
catgagaatttcactcaaagagcagattcaaaagagcgtattattacaaatattcttcat
ttagcagaacttattaaagtggctgagaataaatataaacaccctaatcaactcattaaa
tggtatcgccaccaactcaacaatacagctacaagtgagggtgaacttagattagaaagt
gatgacaacttgattaagataattacaattcatggatcaaaaggacttgagtattccgtc
gtgtttatcccgtttgcttgctatgcaagcacaaagaagtttgagacaagtaattttact
aaatattatgatagtgacctaaaacaaactgtctacaaaattggcaaagatgatagtgtg
aaacagcaagctgataaagaggttatagaagaattaatgcgactattttatgtcgcagtt
acgcgtgcaaagcataggtgttatattggagttgcaaaatataataatagcgaaaagtca
ccattagcaagattcttaggttatcaaaaagatgatgattggttagagaagatccaaagc
ataacagcaaatcctgctaatcaaagtctactgataaatattgcagatatgcgggaattt
agtttaaaaaatttatctagcaaagataaaaattctgattatgatactctcaaagcaaat
tatattagtaaactagaaaatgatagttgggaaatgttatctttttcaaaaatatcaaag
tcaaaagttcaaaatactgcattagaaaaagaaattgacgaggcagaagatgataaaact
caagcttcagacagaaagctagcatttagatttacagcttcaaaaggagctgatatgggt
aatattctgcataatgttttagaacatacagattttagtttaggtgagatagatggtaat
cttttaaaagagcaaatggatagatataaagtagttgctgcagaagacttcgataatctt
aaattatggttggaagaatgtttagaagcacatataccttatatagataccagtttttct
agctcaaatgagagtattcaatatggtttatttgatatcaaggataaaggcttttgctta
aaaactatcccaaattcgaaaactctaaaagaggcggagttttattttcctgttaaaaat
gagaatttgtataaaacaaatatattagaaatcttgcaagagtatagagagcttacaaaa
ctgaagacatatagtcattcctacgtaggtgggaatctttcaactaactaccaggatcta
agagatatctgcctccgcgagtatgacaattttactaatttttcgaatcaaaagattttt
ggtatgcttcatggttttatagatcttatttttgagtatgagggtaaattttatgttgct
gattataaatcaaattatctaggtgatactctagaagattataatcagcaggcgatgcaa
gagaaaaatcaaagtagcttttatgatttgcaatatttgatatatagcgttgctttagat
aagtacctgcgacaaaacattgaaagttataattatgaaaagcattttggcggagtatat
tatttttatcttagaggtatgaaagatggttatggagtttatcaagctagaccaacttta
gagattatcaacaaacttgctagtttatttaatggagatgataatgtataa

DBGET integrated database retrieval system