KEGG   Francisella tularensis subsp. novicida U112: FTN_1631Help
Entry
FTN_1631          CDS       T00432                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ftn  Francisella tularensis subsp. novicida U112
Pathway
ftn00010  Glycolysis / Gluconeogenesis
ftn00051  Fructose and mannose metabolism
ftn00562  Inositol phosphate metabolism
ftn01100  Metabolic pathways
ftn01110  Biosynthesis of secondary metabolites
ftn01120  Microbial metabolism in diverse environments
ftn01130  Biosynthesis of antibiotics
ftn01200  Carbon metabolism
ftn01230  Biosynthesis of amino acids
Module
ftn_M00002  Glycolysis, core module involving three-carbon compounds
ftn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ftn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTN_1631 (tpiA)
   00051 Fructose and mannose metabolism
    FTN_1631 (tpiA)
   00562 Inositol phosphate metabolism
    FTN_1631 (tpiA)
Enzymes [BR:ftn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FTN_1631 (tpiA)
Exosome [BR:ftn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FTN_1631 (tpiA)
  Exosomal proteins of bladder cancer cells
   FTN_1631 (tpiA)
  Exosomal proteins of melanoma cells
   FTN_1631 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM AAA_14 PEP_hydrolase
Motif
Other DBs
NCBI-ProteinID: ABK90489
UniProt: A0Q8C4
Structure
PDB: 

Position
complement(1741302..1742063)
Genome map
AA seq 253 aa AA seqDB search
MQKLIMGNWKMNGNSTSIKELCSGISQAQYDTSRVAIAVFPSSVYVKEVISQLPEKVGVG
LQNITFYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTIT
PVVCIGESLDDRQSGKLKQVLATQLSLILENLSVEQLAKVVIAYEPVWAIGTGVVASLDQ
IQETHQFIRSLLAKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKAAEF
NEIINQANKICTE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattaataatgggtaactggaaaatgaatggtaactctacaagcataaaagag
ctctgtagtggtatatcacaagcgcaatatgatacttcaagagtagctattgctgttttt
ccatcaagtgtttatgttaaagaagtaatctcacagctgccagagaaagtaggtgttggt
ctacaaaatattactttttatgatgatggtgcttatactggcgagatatctgctagaatg
ttggaagatattggttgtgactatttactaattggtcattctgagagaagatctctattt
gctgagtctgatgaagatgtttttaaaaagcttaacaagattatagatactactataacg
ccagtagtgtgtattggtgaatcattagatgatagacaaagtggtaagctcaaacaagtt
ttagcaacacaactaagcttaatcttagaaaatttatctgttgagcagctagcaaaagtc
gtaattgcatatgaacctgtctgggcaataggcacaggagttgtggcttcactagatcag
attcaagaaacacatcaatttattcgttcattgttagctaaagttgatgaaagacttgct
aaaaatataaaaatagtgtatggtggtagcctaaaagctgaaaatgctaaagatatatta
agcttaccagatgttgacggtggtttaattggtggcgcatctttgaaggctgctgaattt
aacgaaataataaatcaagcaaacaagatatgtacggaataa

DBGET integrated database retrieval system