KEGG   Francisella tularensis subsp. novicida U112: FTN_1740Help
Entry
FTN_1740          CDS       T00432                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ftn  Francisella tularensis subsp. novicida U112
Pathway
ftn00260  Glycine, serine and threonine metabolism
ftn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ftn01100  Metabolic pathways
ftn01110  Biosynthesis of secondary metabolites
ftn01130  Biosynthesis of antibiotics
ftn01230  Biosynthesis of amino acids
Module
ftn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ftn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FTN_1740 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FTN_1740 (trpA)
Enzymes [BR:ftn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FTN_1740 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ABK90592
UniProt: A0Q8M7
Structure
PDB: 

Position
1868014..1868820
Genome map
AA seq 268 aa AA seqDB search
MDRYTTLFANLEKRNEGAFIPFVTIGDPNKELSLEIIDTLVSSGADALELGIPFSDPLAD
GPTIQEANIRALESGITPKDCFDVLTKIRAKYPDIPIGLLLYANLVYANGIENFYQKCLD
AGVDSILIADVPAHESKEFRDIAKKVGIAQIFIAPPDASESTLKQISELGSGYTYLLSRV
GVTGTETAANMPVEDVLAKLREYNAPKPVLGFGISKPEQVQQAIKAGAAGAISGSATVKI
IQNNISNKQKMLNELTYFVKEMKAATLN
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggatagatatacaaccctttttgcaaatttagagaaaagaaatgaaggagcttttata
ccttttgtaacaattggtgacccgaataaagaactatctcttgaaattatcgatactcta
gttagctcaggtgctgatgctcttgagttgggtatacctttttcagatcccttagcagat
gggccaacaattcaagaagcaaatattcgcgctctggagagtggaataacccctaaagat
tgtttcgatgttctaactaaaataagagcaaaataccctgatatccctattggtttacta
ctttatgctaatttagtctatgcaaacggtatagagaacttttatcaaaaatgtttagat
gcaggtgttgattctatacttatagctgatgtaccagctcacgaatctaaagagtttcgt
gatattgctaaaaaagttggtatagcacaaatatttatcgctcctcctgatgctagtgag
tcaactcttaaacaaatttctgaacttggtagtggttatacgtatttactatcgagagtt
ggtgtaacagggacagaaactgctgcaaatatgcccgtcgaggatgtattggctaaactt
agagaatataatgctcctaaaccagttttaggctttggtatctctaaacctgagcaagta
caacaagctatcaaagctggtgctgctggtgcaatttcaggctcagcaacagtgaaaatt
attcaaaataatatctctaataaacaaaaaatgcttaatgaacttacatattttgttaaa
gagatgaaagcagctactttaaattaa

DBGET integrated database retrieval system