KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_00125Help
Entry
NE061598_00125    CDS       T01938                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
ftr00970  Aminoacyl-tRNA biosynthesis
ftr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NE061598_00125 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ftr03029]
    NE061598_00125 (gatB)
Enzymes [BR:ftr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     NE061598_00125 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     NE061598_00125 (gatB)
Mitochondrial biogenesis [BR:ftr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    NE061598_00125 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ADA77700
Position
19730..21139
Genome map
AA seq 469 aa AA seqDB search
MVIGLEVHIQLSTKSKLFSTSATKYGQHQNTQAAFLDLGLPGTLPVVNKEAIRKAVIFGL
AVDAKISKDSFFARKNYFYPDLSKGYQISQSTNPIVQEGRLEIETSKGLKTIRIERAHLE
EDAGKSVHGYIAGETGLDYNRAGTPLLEIVTYPDFRSAEEVVAYLKKLHQLVKHLGICDG
NMQEGSFRCDVNLSIRPQGQAKFGTRAELKNINSFRFIDKAIEYEYARQVSVLESGGEVV
QETRLYDADANETRSMRAKEDAFDYRYFPDPDLLPLVITDEYIESIKKQMPLKSEEREAV
YREHLAEQEVEFLLSNLEIADYYDKVAVVIGYKPAYNWITVDLISTLNRAEKEFSSDVVP
AEILLEIIANVQKDIISQANAKKVIAEYIDAPSAIEAIIEKLGLKQVSDEGMIRELVQGI
IAANPQQAADFKAGKTKLMSFFVGQAMKASKGKANPKQVNQIVQEELNK
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggtgatagggctagaagtccatattcaattaagtactaaatctaagctattttcgact
tctgcaacaaagtatggtcaacatcaaaatactcaagcagcatttttagacttaggtttg
cctggaacgttgcctgttgtaaataaagaagctattcgtaaagcagtgatatttggctta
gctgtagatgctaagatatcaaaggatagtttctttgcgcgaaaaaattatttctatcca
gatttatcaaaaggttatcagattagtcaatcaactaatccaatagtccaagaaggtaga
ttagagattgaaacttcaaaaggactaaaaactatcagaattgagcgtgcacatttagaa
gaagatgccggtaagtctgtgcatggttatattgctggtgagacaggattagattacaat
cgtgctggtacaccacttttagagattgtgacatatcctgattttagatcggctgaagaa
gtggttgcatatcttaaaaaacttcatcagctagttaagcatttaggtatttgcgatggt
aacatgcaagaaggttcgtttagatgtgatgttaacttgtcaattagaccacaaggacaa
gctaagtttggtacacgtgcagagcttaaaaatataaactcatttaggtttattgataaa
gctatcgagtatgagtatgctcgccaagttagtgtgttggagtcagggggcgaagttgtc
caggaaacgcgtctttatgatgcagatgctaatgagacgcgctcaatgcgtgcaaaagaa
gatgcttttgattatcgttatttcccagatccagatttattgccattggtgataaccgat
gagtatatcgagagtatcaaaaaacaaatgccactgaaatcggaagagcgtgaagcggta
tatcgtgagcatctagctgagcaggaagttgagtttttattatcaaatcttgagatagct
gattactatgacaaagtagcagttgtgataggatacaagccagcttataattggataaca
gttgatctaatatcaactcttaatagggctgaaaaggagttttctagtgatgttgttcct
gctgagattctgctagaaattattgctaatgtccaaaaagatataatatctcaagctaat
gctaagaaagtgatagcagaatatattgatgctcctagtgcaattgaagctattattgaa
aagctcggtctaaaacaagtatctgatgagggtatgattcgcgagttagttcaaggtata
attgctgctaaccctcaacaagcagctgactttaaagctggtaaaacaaagcttatgagc
ttttttgttgggcaagctatgaaagcaagtaaaggtaaagcaaatcctaagcaggttaat
caaatagttcaagaagagctaaataaataa

DBGET integrated database retrieval system