KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_02160Help
Entry
NE061598_02160    CDS       T01938                                 

Definition
(GenBank) nicotinamide-nucleotide adenylyltransferase
  KO
K13522  bifunctional NMN adenylyltransferase/nudix hydrolase [EC:2.7.7.1 3.6.1.-]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
ftr00760  Nicotinate and nicotinamide metabolism
ftr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NE061598_02160
Enzymes [BR:ftr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     NE061598_02160
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     NE061598_02160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: ADA78080
Structure
PDB: 

Position
388002..389045
Genome map
AA seq 347 aa AA seqDB search
MYDISVFIGRFQPFHKGHLHNIIIALQNSKKVIINIGSCFNTPNIKNPFSFEQRKQMIES
DLQVAGIDLDTVVIEPLADYFYQEQKWQDELRKNVYKHAKNNNSIAIVGHIKDSSSYYIR
SFPEWDYIGVDNYKNFNATEFRQKFYNGIISKQYMCSNDPKLGTYNFLTKFMDTQVYQDL
VAENNYVIEYKRLWLKAPFKPNFVTVDALVIVNDHILMVQRKAHPGKDLWALPGGFLECD
ETIAQAIIRELFEETNINLTHEQLAIAKRCEKVFDYPDRSVRGRTISHVGLFVFDQWPSL
PEINAADDAKDVKWISLGSNIKNICDRMLEDHYQIITILLEECGKKL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatatttcagtttttataggaagatttcagccttttcataagggtcacttacat
aatataataatagcgctacaaaatagcaaaaaagttataattaatattggtagttgtttt
aatacaccaaatataaaaaaccctttttcttttgagcaaagaaaacagatgatagagagt
gatttacaagtcgctggaattgatttagatactgtagtcatagagcctttggctgactat
ttttatcaagaacaaaagtggcaggatgaattacgtaaaaatgtctataagcatgctaaa
aataataatagtatcgctatcgttgggcatattaaggatagttctagctattatataaga
agttttcctgaatgggattatataggagttgataattataaaaactttaatgccactgaa
tttaggcaaaagttttataacggcattatatcaaagcaatatatgtgtagtaatgaccct
aaattaggtacttataactttttgacaaagtttatggatacacaagtatatcaagactta
gttgcagaaaataattatgttattgagtataaaagattatggctgaaagctccatttaag
ccaaactttgtgacggttgatgctttagttatagtgaatgatcatattctgatggtacag
aggaaagctcaccctggcaaagatttatgggcactgcctgggggatttctagagtgtgat
gaaactatcgcacaagctataattcgagaattatttgaagaaacaaatatcaacctaact
catgagcaactcgctatagcaaaacgctgtgaaaaagtttttgattatcctgatcgttca
gtaagaggtagaacaattagccatgttgggttgtttgtttttgatcaatggccaagctta
ccagagattaatgctgccgatgatgcaaaggatgtcaaatggatatctttgggctcaaat
attaaaaatatctgtgatagaatgttagaagatcattatcaaattatcacgattttatta
gaggaatgtggtaagaaactataa

DBGET integrated database retrieval system