KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_10290Help
Entry
NE061598_10290    CDS       T01938                                 

Gene name
purT
Definition
(GenBank) phosphoribosylglycinamide formyltransferase 2
  KO
K08289  phosphoribosylglycinamide formyltransferase 2 [EC:2.1.2.2]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
ftr00230  Purine metabolism
ftr00670  One carbon pool by folate
ftr01100  Metabolic pathways
ftr01110  Biosynthesis of secondary metabolites
ftr01130  Biosynthesis of antibiotics
Module
ftr_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:ftr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NE061598_10290 (purT)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NE061598_10290 (purT)
Enzymes [BR:ftr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     NE061598_10290 (purT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp Dala_Dala_lig_C CPSase_L_D2 RimK ATP-grasp_3 GARS_A ATP-grasp_4 ATPgrasp_ST Epimerase
Motif
Other DBs
NCBI-ProteinID: ADA79476
Position
complement(1854004..1855140)
Genome map
AA seq 378 aa AA seqDB search
MLLGSGELGKEFIIAAQRLGIHTIVVDRYKNAPAMQVAHESYVIDMLNSDALEQLILAKN
PTYIVPEIEAINTDSLVKLEAHNFNIIPCAKAAKLTMDRQGIRALAAQQLNLQTSKFAFA
NSEQEYLDVIQSIGLPFVIKPVMSSSGKGQSIVKEHNEIKKAWDYAQNGSRGHAKGVIVE
QFIDFDYEITLLTVRHKDGTSFCDPIGHIQKDGDYRFSWQPHTMPDTALAKSQEIAKEIT
DALGGYGVFGVELFIKGDEVFFNEVSPRPHDTGMVTLISQNINEFELHLRAIVGLPIPDI
QTLQPSASAAILLEGDTANASICGIDKALADANVDIRIFGKKEIHGKRRMGVVLAKAQNT
HIALETSKQALAHIHLTK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgttgcttggttcaggtgaactaggcaaagaattcataatagctgctcaaagacttggt
atacacactatagttgtagatcgatataaaaatgcaccagctatgcaagtagctcacgaa
agctatgttatagatatgctaaattcagatgctcttgagcaactaattctagcaaaaaat
ccaacgtatatagttcctgaaattgaagctataaataccgatagcttagtaaaactagaa
gctcataacttcaatattatcccatgtgcaaaagccgcgaaactaactatggatcgccag
ggtataagagctttagctgcacaacagcttaatttacaaacatcaaaatttgcatttgca
aatagcgagcaggaatatctagatgtaatacaatcgattggtctaccatttgtgattaag
cctgtaatgagctcttcaggtaaaggtcaatcaattgttaaagaacataatgaaattaaa
aaagcttgggattatgctcaaaatggctctcgaggccatgctaaaggtgtaattgtagaa
caatttatagattttgactatgagataacgctactaactgttagacataaagatggtact
tcattttgcgaccctattggacatatccaaaaagatggtgattatcgcttctcttggcaa
cctcatacaatgccagatacggctttagcaaagtcacaagaaattgctaaagaaatcacc
gatgcattaggtggctatggagtttttggagttgagttattcataaaaggtgatgaggta
ttttttaatgaagtctcacctcgtcctcatgacacggggatggtgacacttatatctcaa
aatatcaacgaatttgagctacatcttcgtgcaatagttggactacctatacctgatata
cagacattacagccatctgcttctgcagcaatattacttgaaggagatactgctaacgca
agtatttgcggtattgataaagcattagctgatgcaaatgtagatataagaatatttggc
aaaaaagaaatacatggtaaacgccgtatgggagttgtcttagcaaaagcacaaaatact
cacatagctttagaaacttctaagcaagctctagcacatattcatcttactaaataa

DBGET integrated database retrieval system