KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_10460Help
Entry
NE061598_10460    CDS       T01938                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
ftr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ftr01100  Metabolic pathways
ftr01110  Biosynthesis of secondary metabolites
ftr01130  Biosynthesis of antibiotics
ftr01230  Biosynthesis of amino acids
Module
ftr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ftr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NE061598_10460
Enzymes [BR:ftr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NE061598_10460
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     NE061598_10460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADA79504
Position
complement(1882912..1884273)
Genome map
AA seq 453 aa AA seqDB search
METILAKIVEAKRKWLFAKKRLFPLDVFKKEVVKTDRDFYQALESDKAVFILECKKGSPS
KGIIRKKFDLNEIAAVYKNYANVISVLTDEEFFMGSFANLEIVRKQVTQPMLCKDFIIDE
YQIFLARHYQADAVLLMLSVLDDSEYKKLAKVANRLGMGILTEVSNEEELVRAISLKAKV
IGINNRNLRDLSIDLNTTRLLAPKIPKGTIIISESGIYKNQEIRDLRNYVNGFLIGSSIM
GERNLELAVRKLVYGFNKVCGLTSVEDAQKAYDAGAVYGGLIFVEKSPRYVDFAMAKQIV
KKVRLNYVGVFADAKIEDVVDTCYALKLSAVQLHGDENQEYIDTLKSKLYRNCQIWKAYP
VDKTLPSFFANVDYHLLDAQVDGKSGGTGKTFDWSLIKDRKNIILAGGLNAKNIAKAIEL
KCSAYDINSGVESEPGQKDQIKLNEVFEIIRSY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggaaactattttagcaaaaatcgttgaagcaaaaagaaagtggctttttgcaaaaaaa
agactatttccactagatgtatttaaaaaagaagttgtcaaaacagatagagatttctat
caagctttggaatctgataaagctgtatttattttagaatgtaaaaaaggctctccttct
aaaggaattattcgtaaaaagtttgatctaaatgaaattgcagctgtatacaaaaattat
gcaaatgtgatatctgtacttacagatgaagaattttttatgggtagctttgcaaatcta
gagattgttagaaagcaagtaacacaacctatgctttgtaaagattttataatagatgaa
tatcaaatattcttagctaggcattatcaagctgatgctgtgttacttatgctttcagta
cttgatgatagtgagtataaaaaattagcaaaagttgctaatcgtctaggtatgggtata
ttaaccgaagttagtaacgaagaagagcttgtaagagctataagcttaaaagcaaaagtt
ataggtattaataatcgtaatctaagagatctttctatagatttaaatactacgcgtctt
ttagctccgaaaatacctaaaggaacaattattatttcagaatcagggatctataaaaat
caagaaatacgtgatctaagaaattatgtaaatggctttttgataggaagttctattatg
ggtgaacgtaaccttgaacttgcagttagaaagcttgtttatggttttaataaggtttgc
ggccttacttctgttgaggatgctcaaaaagcatatgatgcaggagcagtctatggtggt
ttgatttttgttgagaaatctcctcgttatgtagattttgccatggcaaaacagatagta
aaaaaagttaggctaaattatgtaggtgtttttgctgacgctaaaatagaagatgttgta
gatacctgctatgcattaaaattaagtgctgtgcagttgcatggtgatgaaaatcaagag
tatatagatactctaaaatcaaagctatatagaaactgtcaaatatggaaagcatatcca
gtagataagactcttccaagtttttttgctaacgtagattatcatttattagatgcccaa
gtagatggtaaatcaggtggtacaggaaaaacatttgattggagtcttatcaaagacaga
aaaaatataattcttgctggcggtctgaatgctaaaaatatagcaaaagcaatagaattg
aagtgttcagcttatgatattaattctggtgtagaatctgaaccaggacaaaaagatcaa
atcaaactaaatgaagtatttgaaataattagaagttattaa

DBGET integrated database retrieval system