KEGG   Francisella tularensis subsp. holarctica F92: F92_00645
Entry
F92_00645         CDS       T02349                                 

Definition
(GenBank) hypothetical protein
Organism
fts  Francisella tularensis subsp. holarctica F92
SSDB
Other DBs
NCBI-ProteinID: AFX69831
Position
complement(111900..113051)
AA seq 383 aa
MSQIISTLNNIDLVTQDKVNLISNMQIQAKYENAEYKSFIDQLIDNLNTTRSIDIYNLFL
SLNSEICLNLDTVDNISKIISSYLSILNTNFTRISPSESKQKNQLAEKGINKFLVTMDAN
FAQMQNQDKLLPNNIDSIIEIVQEVIIFFEKNNLNYNSDFKIQLNKTLRKIKSSLILKDQ
KNDTYSDKESINQVEATITDQKTIQGSEKWKTLIEKIEVLKALVESERMFETSIVYNDIQ
NLLVNFDPKEYFPEIFFPLYKKIAPFIGNIHKNIDYYSSSIQWSIAQKMYNIDYKSFLDT
LEKMPENNFLNSSSDITKNFFYETSSEVEKTPIEEHKIIADTDAIKEEIVIKQRTNNKKN
QNDPVEKISNKIDEDYFEDLFDI
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgagtcagataatatctacactaaataatattgatttagtaactcaagataaagtaaat
ctgattagtaatatgcaaatacaagcaaaatatgaaaacgctgagtataagtcatttatt
gatcaattaatagataatcttaatactactagaagcatagatatatataacttatttcta
tctttaaattcagaaatatgcctcaatttagatacggttgataatatctctaaaattatt
agctcttatttatctattctaaatactaatttcacaagaattagtccatcagaatcaaag
caaaaaaaccagctagctgaaaaaggaataaacaaattcttagtcactatggatgcaaat
tttgcgcaaatgcagaatcaagacaagttgttaccaaataacatagattctattatagaa
attgtacaggaagtaataatattttttgagaaaaataacttaaattataattctgatttt
aaaatccaactaaataagactctcagaaaaataaaaagttctttgattttaaaagatcaa
aaaaatgatacgtattccgataaagaatcaataaatcaagttgaagcaactatcacagat
caaaaaaccatacaaggctctgagaaatggaaaactcttattgaaaaaattgaagtttta
aaagctctagttgaaagtgaaagaatgtttgaaacatctattgtttataatgatatacaa
aacttattagttaacttcgatcctaaagagtattttccagaaattttctttccattatac
aagaagatagctccttttattggcaatatccataaaaacatagactactactcatcaagt
attcagtggagtatagctcagaagatgtacaacatagattataagagttttctagatact
cttgagaaaatgcccgaaaataattttttaaattcttcttctgatataactaaaaatttc
ttttatgaaacatcctcagaggtggaaaaaactcctatcgaagaacataaaataattgca
gatacagatgctatcaaagaagaaatagtaataaaacagcgaaccaataataaaaaaaac
cagaatgaccccgtagaaaaaatttcaaataaaatagatgaagactattttgaagatctt
tttgacatataa

DBGET integrated database retrieval system