KEGG   Francisella tularensis subsp. holarctica F92: F92_00665
Entry
F92_00665         CDS       T02349                                 

Definition
(GenBank) hypothetical protein
Organism
fts  Francisella tularensis subsp. holarctica F92
SSDB
Motif
Pfam: DUF4280
Other DBs
NCBI-ProteinID: AFX69833
Position
complement(115150..115671)
AA seq 173 aa
MLNIINDSLKRLKEITTNDESISSSVSDLVADLNNIKILLAQSKLHLSSNASILTTSMGA
QIKCSYSLGSGIYLSTRIKTLTNNLPASNITDSKLGANILPFAGCTNPANPTMNPFSFPW
VCIPNLSAFIPTNPTTLLENAPITTINSKAMCMFAPGGIVDFISSGQINVKTS
NT seq 522 nt   +upstreamnt  +downstreamnt
atgttaaatattataaatgactccttaaaacgcttgaaagaaataacgaccaatgatgaa
agtattagtagctcagtatctgatctagtggcggatttaaacaatataaaaattttatta
gctcaatcaaaactacacttatcaagcaatgcgtcaatattaaccacatcaatgggagca
caaattaaatgctcatatagtcttggatcaggaatttatcttagtacaagaataaaaaca
ctaacgaacaacttaccagcttcaaatattaccgattctaaactaggagctaacatttta
ccttttgctggatgtacaaatccagcaaaccctacaatgaacccatttagctttccttgg
gtatgtataccaaacttatctgcttttatccccacgaaccctactacgctactggaaaat
gctcctataactacaataaatagtaaagcaatgtgtatgtttgctccgggtggtatagtt
gattttattagtagtggacaaataaatgtaaaaacatcttag

DBGET integrated database retrieval system