KEGG   Francisella tularensis subsp. holarctica F92: F92_00770Help
Entry
F92_00770         CDS       T02349                                 

Definition
(GenBank) ribonuclease II family protein
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
fts  Francisella tularensis subsp. holarctica F92
Brite
KEGG Orthology (KO) [BR:fts00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fts03016]
    F92_00770
Enzymes [BR:fts01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     F92_00770
Transfer RNA biogenesis [BR:fts03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    F92_00770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB
Motif
Other DBs
NCBI-ProteinID: AFX69850
Position
143940..145790
Genome map
AA seq 616 aa AA seqDB search
MQKNSLVIFKSKPAKVINLLDKKIEIETLDGKNIKLPAKSVQLLVESEKYFELESLKELE
IAELEMTWELLQEQQQTSVEELCELLFESIGVNQAYTVWLLVSEGEYFSFNDDFSINIHS
QEQKNAIVRDKQEKLKKEQELNDFIERLNNKTFNEDDRKFLKEIEALATLKTNKCRFFKY
LNMEESENSAYKLLLDIGYCDEFFNPYLYRYGAELEHNSAEFNYNSKSDNQRVDLTHLKA
YAIDDEGSNDPDDAISWDSQKNKMWVHISDPSSSISFGDEVDLQARARGSNLYVPEQIVM
MLPPQATAKLGLGLQEVSPAVSVGFRIDEQGDIHDIEICFSNIKVTRYSYEFVEENMHTL
ELGDIVSYAKYFTDKRLSKGAVELDFPEIKISLDANKNVKLTDLPRLNSRTLVRDTMLMA
GVAVGQFCIKNNISVSFSTQPEHDLGQDGLENIDSIADMFATRKKLQRGRYSTQPSMHAG
MGLEAYVQVTSPLRRYLDLIVHYQLRNFLQHKEMISAQEIDNIIAQVDIPIKSNRQTERF
SNSHWKLVYLIQNPDLEFQATVIEKLEKSRLMVSIAALAMTKKLSVSGKYDLNDQIKLQN
TSVNLVTQEAFFRVIE
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaaattctctagtaatatttaaatctaaaccagcaaaggttattaatctctta
gataaaaaaattgagattgagactctcgatggtaaaaatattaagttacccgcaaagagt
gttcaattacttgtagagtcagaaaagtattttgaacttgaaagtttaaaagagctagaa
atagctgaacttgaaatgacttgggaattattacaagagcaacaacaaacatctgttgaa
gaactatgtgagttactttttgaatctataggggtaaatcaggcttataccgtgtggctt
ttagtttcagaaggagagtattttagctttaatgatgattttagtatcaatattcattca
caagagcaaaaaaatgcaatagttagagacaaacaagagaaacttaaaaaagagcaagaa
cttaatgatttcatagagcgtttaaacaataaaacttttaatgaagatgataggaaattt
cttaaggaaatagaagctctagcaacacttaaaactaataagtgtcgtttttttaagtac
ttaaacatggaggagtctgagaatagtgcgtataaattgcttttggatattggctattgt
gatgagttttttaacccttatttatacaggtatggtgctgagttagaacataattctgca
gagtttaactacaattctaaatcagataaccagagagtagatctgacacatttaaaggct
tatgctatagatgatgaaggtagtaatgatcctgatgatgcaattagttgggatagccaa
aaaaataaaatgtgggtacatatctcagatccttcttctagtattagttttggtgatgag
gttgatcttcaagctagagcacgaggctcaaatttatatgtgccggaacagatagtcatg
atgttacctcctcaagcaacagcaaaattaggcttaggcttacaggaggtatctcctgca
gtatctgtaggatttaggattgatgagcaaggtgatatccatgatattgaaatatgcttt
agtaatataaaagttacacgatattcttatgaatttgttgaagaaaatatgcatacttta
gagcttggcgatatagtaagttatgcaaaatatttcactgataagcgtttatctaaaggt
gcagttgagcttgatttcccagagataaagatatcattagatgctaataaaaatgttaaa
ttaactgatttaccacgtttaaactcaaggacacttgtacgagatacaatgctaatggct
ggtgttgcagtaggacagttttgtattaaaaataatattagtgtatccttttctacacag
cctgaacatgatcttggacaagatggtttagagaatatcgattcaatagctgatatgttt
gcaacacgcaaaaaactccaaagaggcagatattctacacaacctagtatgcatgcaggg
atgggattagaagcctatgtacaagtgactagtccattgagaagataccttgatttgatt
gtacactatcagttacgtaattttctgcagcataaagagatgataagtgctcaagagatt
gataacataattgctcaagttgatattcctataaaatcaaatagacaaactgagcgtttc
tcaaattcacactggaagttggtttacctaatccaaaatcctgacctggaatttcaagcg
acagttattgagaaattagaaaaaagtagattaatggtttctattgcagctttagcgatg
actaaaaaactttctgtcagcggtaagtatgatttaaatgatcaaataaagttacaaaac
acctcagtaaaccttgttacacaagaggctttctttagagttattgaataa

DBGET integrated database retrieval system