KEGG   Francisella tularensis subsp. holarctica F92: F92_07080Help
Entry
F92_07080         CDS       T02349                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
fts  Francisella tularensis subsp. holarctica F92
Pathway
fts00010  Glycolysis / Gluconeogenesis
fts00052  Galactose metabolism
fts00500  Starch and sucrose metabolism
fts00520  Amino sugar and nucleotide sugar metabolism
fts00521  Streptomycin biosynthesis
fts01100  Metabolic pathways
fts01110  Biosynthesis of secondary metabolites
fts01120  Microbial metabolism in diverse environments
fts01130  Biosynthesis of antibiotics
fts01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fts00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F92_07080
   00052 Galactose metabolism
    F92_07080
   00500 Starch and sucrose metabolism
    F92_07080
   00520 Amino sugar and nucleotide sugar metabolism
    F92_07080
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    F92_07080
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    F92_07080
Enzymes [BR:fts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     F92_07080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK DUF960 IF2_N ATLF
Motif
Other DBs
NCBI-ProteinID: AFX70922
Position
complement(1213206..1214090)
Genome map
AA seq 294 aa AA seqDB search
MSKEIQIKNRTVVGVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIA
KVFTSEVEGIGVGISSVADREKGIVYDVQNIKSWQDIHLKEILEAEFKVPVFIDNDANCF
AIGQRLYGKGKQYENFVGITIGTGIGGGIINKGSLLKDSNCGAGEFGMLPYLDGILEDYC
SGQFFIKKIGVEGVEILKRARNNDKDAINIYKQFGKHLGVAIKSIMYTLDPEVIIIAWSI
ISAREFFEKAMWDEIKTFAFTQSAKKIKIEWSETEGDFQVFSAAAVYLDRSSNL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagaaattcaaattaagaatagaactgtggttggtgttgatatcggtggcact
aaagtgaatgctggtagggtatgtggagaaaatctattagactcttacttgagcaaaatt
ccaccagatgcagaacataatgctcaatctgttattgatgttgtcataaatactatagca
aaagttttcacctctgaagtagaaggtattggcgttgggatttctagtgttgcagatcga
gaaaagggaattgtatatgatgtgcaaaatatcaaatcatggcaagatattcatctaaag
gaaatactagaggcagaatttaaagtaccagtttttatagataatgatgcaaactgtttt
gctattggacaaagactatatggtaaaggcaaacaatatgaaaattttgttggtattaca
ataggtactggtattggtggaggaattataaataaaggctccttactaaaagactctaat
tgcggtgctggagaatttggcatgttgccatatctagatggaattttagaagattattgt
agtggtcaattttttataaaaaagattggtgttgaaggtgttgagattctcaagcgtgca
agaaataatgataaagatgctataaatatctataaacaatttggtaaacatcttggagta
gcaataaagtctattatgtatactctagacccagaagtgataataatcgcatggtcaata
atatcagccagagagttttttgaaaaagcaatgtgggatgagattaaaacatttgccttt
actcaatcagctaaaaaaattaaaatagaatggtcagaaacggagggagattttcaggtt
tttagcgctgcagctgtttatttggatagaagtagcaatttataa

DBGET integrated database retrieval system