KEGG   Francisella tularensis subsp. tularensis TI0902: FTV_0983Help
Entry
FTV_0983          CDS       T01761                                 

Gene name
yrbI
Definition
(GenBank) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
  KO
K03270  3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC:3.1.3.45]
Organism
ftt  Francisella tularensis subsp. tularensis TI0902
Pathway
ftt00540  Lipopolysaccharide biosynthesis
ftt01100  Metabolic pathways
Module
ftt_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:ftt00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    FTV_0983 (yrbI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ftt01005]
    FTV_0983 (yrbI)
Enzymes [BR:ftt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.45  3-deoxy-manno-octulosonate-8-phosphatase
     FTV_0983 (yrbI)
Lipopolysaccharide biosynthesis proteins [BR:ftt01005]
 Unusual sugar
  FTV_0983 (yrbI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 Hydrolase HAD_2 Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AFB80658
Position
complement(1037344..1037892)
Genome map
AA seq 182 aa AA seqDB search
MKINHSRNSINIKLLILDVDGVLTDGKIIVTNDGDELKNFDVKDGLGIVLMQKLGIKVAI
ITGKQSKIVDDRFKNLGLDPEDILQGQKNKLKAYEFLKSKYKLNDSDIAYMGDDLPDIIL
MNKVAISAAPADAMAIAKDYADYVCKADGGAGAVREFCEYLIKQLNLYDKIVDDYIQSGG
VR
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaatcactcaagaaactcaataaatattaaactgttgattctcgatgtagat
ggtgtgttaacagatggcaaaataatagtaactaatgatggtgacgagcttaaaaatttt
gatgtcaaagatggtttagggattgtccttatgcagaaacttggaatcaaagttgctatt
atcacaggtaaacaatcaaaaattgtcgatgatagatttaaaaacttaggattagatcct
gaagatattttgcaaggtcaaaaaaataaactaaaagcttatgaatttctcaagtcaaaa
tataagctaaatgatagtgatatagcatatatgggagatgatttgccagatataatcttg
atgaataaagtagccatttctgcagcaccagctgatgctatggctattgccaaagattat
gctgattatgtttgtaaagctgatggcggtgctggtgcagtaagagaattttgtgaatat
ctaatcaaacaattaaatctctatgacaagattgtggatgattatattcaaagtggcgga
gtgagataa

DBGET integrated database retrieval system