KEGG   Francisella tularensis subsp. tularensis TI0902: FTV_1490Help
Entry
FTV_1490          CDS       T01761                                 

Gene name
ispA
Definition
(GenBank) Octaprenyl-diphosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
ftt  Francisella tularensis subsp. tularensis TI0902
Pathway
ftt00900  Terpenoid backbone biosynthesis
ftt01100  Metabolic pathways
ftt01110  Biosynthesis of secondary metabolites
ftt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ftt00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FTV_1490 (ispA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ftt01006]
    FTV_1490 (ispA)
Enzymes [BR:ftt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     FTV_1490 (ispA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     FTV_1490 (ispA)
Prenyltransferases [BR:ftt01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   FTV_1490 (ispA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt CK2S
Motif
Other DBs
NCBI-ProteinID: AFB81119
Position
1623660..1624541
Genome map
AA seq 293 aa AA seqDB search
MSSENIIKDFEIFAEKVFDQLNCVSKTLLSAMHYSFFSGGKRIRAQFVYAIGEALAIDKS
NCDKIAFAVESIHTYSLIHDDLPAMDNDTLRRGKPTCHIKFNEATAILAGDALQALAFEI
LQDINYSDIDKLKKINKLFAQYCGASGMVGGQQLDIEGENKKLKIEELQILHTNKTAKMF
RACIVLPYILSQNQNSQIEDLLVRLSDLIGLCFQIKDDILDVTKTTNELGKTSAKDIDAN
KSTYVSLMGLKDANKYLLDKKNEITQIITKLKNNNFSSTSLENLIDLVINRNC
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgaaaatataataaaagatttcgaaatttttgctgaaaaggtatttgatcaa
cttaactgtgtatccaaaactttactaagtgcaatgcactatagcttttttagtggtggc
aaaagaataagagcacaatttgtttatgctattggtgaagctctagctatagataagtca
aactgtgataaaatcgcatttgcagtagagtctattcatacctactcactaatacatgat
gatcttcctgctatggataacgatactctacgtaggggcaaaccaacttgtcatatcaaa
tttaatgaagctactgcaatcttagcgggcgatgctttacaagcattagcttttgaaata
ttacaagatatcaactactcagacatagataaactaaaaaaaataaataaactttttgct
caatactgtggtgctagtggtatggttggtggtcaacaactagatattgagggtgagaat
aaaaaacttaaaattgaagaattacaaatattacataccaataaaactgcaaaaatgttt
agagcatgtatagttttaccttatattctctcacaaaatcaaaatagccaaatagaagat
ttattagtaaggttatcagacttaataggcttatgttttcagatcaaagatgatatctta
gatgtcactaagacaactaacgagctaggaaaaactagcgctaaagatatagatgccaat
aaatcaacctatgtatcattaatgggattaaaagacgcaaataaatatttactagataaa
aaaaatgaaatcacacaaattatcactaagctaaaaaataataacttcagttcaactagt
cttgaaaatctcattgatttagttattaatagaaactgttag

DBGET integrated database retrieval system