KEGG   Francisella tularensis subsp. tularensis TI0902: FTV_1626
Entry
FTV_1626          CDS       T01761                                 

Definition
(GenBank) hypothetical protein
Organism
ftt  Francisella tularensis subsp. tularensis TI0902
SSDB
Other DBs
NCBI-ProteinID: AFB81242
Position
1783789..1784940
AA seq 383 aa
MSQIISTLNNIDLVTQDKVNLISNMQIQAKYENAEYKSFIDQLIDNLNTTRSIDIYNLFL
SLNSEICLNLDTVDNISKIISSYLSILNTNFTRISPSESKQKNQLAEKGINKFLVTMDAN
FAQMQNQDKLLPNNIDSIIEIVQEVIIFFEKNNLNYNSDFKIQLNKTLRKIKSSLILKDQ
KNDTYSDKESINQVEATITDQKTIQGSEKWKTLIEKIEVLKALVESERIFETSIVYNDIQ
NLLVNFDPKEYFPEIFFPLYKKIAPFIGNIHKNIDYYSSSIQWSIAQKMYNIDYKSFLDT
LEKMPENNFLNSSSDITKNFFYETSSEVEKTPIEEHKIIADTDAIKEEIVIKQRTNNKKN
QNDPVEKISNKIDEDYFEDLFDI
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgagtcagataatatctacactaaataatattgatttagtaactcaagataaagtaaat
ctgattagtaatatgcaaatacaagcaaaatatgaaaacgctgagtataagtcatttatt
gatcaattaatagataatcttaatactactagaagcatagatatatataacttatttcta
tctttaaattcagaaatatgcctcaatttagatacggttgataatatctctaaaattatt
agctcttatttatctattctaaatactaatttcacaagaattagtccatcagaatcaaag
caaaaaaaccagctagctgaaaaaggaataaacaaattcttagtcactatggatgcaaat
tttgcgcaaatgcagaatcaagacaagttgttaccaaataacatagattctattatagaa
attgtacaggaagtaataatattttttgagaaaaataacttaaattataattctgatttt
aaaatccaactaaataagactctcagaaaaataaaaagttctttgattttaaaagatcaa
aaaaatgatacgtattccgataaagaatcaataaatcaagttgaagcaactatcacagat
caaaaaaccatacaaggctctgagaaatggaaaactcttattgaaaaaattgaagtttta
aaagctctagttgaaagtgaaagaatatttgaaacatctattgtttataatgatatacaa
aacttattagttaacttcgatcctaaagagtattttccagaaattttctttccattatac
aagaagatagctccttttattggcaatatccataaaaacatagactactactcatcaagt
attcagtggagtatagctcagaagatgtacaacatagattataagagttttttagatact
cttgagaaaatgcccgaaaataattttttaaattcttcttctgatataactaaaaatttc
ttttatgaaacatcctcagaggtggaaaaaactcctatcgaagaacataaaataattgca
gatacagatgctatcaaagaagaaatagtaataaaacagcgaaccaataataaaaaaaac
cagaatgaccccgtagaaaaaatttcaaataaaatagatgaagactattttgaagatctt
tttgacatataa

DBGET integrated database retrieval system