KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0384cHelp
Entry
FTT_0384c         CDS       T00214                                 

Gene name
psd
Definition
(RefSeq) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
ftu00564  Glycerophospholipid metabolism
ftu01100  Metabolic pathways
ftu01110  Biosynthesis of secondary metabolites
Module
ftu_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FTT_0384c (psd)
Enzymes [BR:ftu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     FTT_0384c (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-GeneID: 3191677
NCBI-ProteinID: YP_169429
UniProt: Q5NHR3 A0A0H3TQ88
Position
complement(385993..386844)
Genome map
AA seq 283 aa AA seqDB search
MRDNLFIYLQYLLPHTLTSRLVSKLADSENKIIKNHLIKLAIKKFNINLVEAKETDISKY
KSFNDFFIRELKDDLRPISNDKNVISSPADGVLSQFGTITDNSLIQAKGKLFSLESLIAS
SSTTSFTKFATIYLSPKDYHRVHMPIDGKLTKMVYIPGKLFSVNKITTSKVDNLFAKNER
LICYFDTIIGEIAVIFVGALLVAGIETVWHGKIAPNYYKDIQTWDYNSAKFNIKFNKGDI
LGWFNFGSTVIILTSGNNVSFKFEENKNNIKIQVNQDLALITE
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagagataatttatttatatatttacaatatctacttcctcacactttaacatcacgt
ttagttagtaaacttgctgactcagaaaataaaattattaaaaaccatctaataaaactt
gctattaagaaattcaatattaatttagttgaagctaaagaaaccgatataagcaaatac
aaatcttttaatgattttttcataagagaacttaaagatgatttaagacccatttctaat
gataaaaatgttatctcctctcctgcagatggtgtattaagtcaattcggcacgataact
gataatagtctaattcaagccaaaggtaaactcttttctctagaatcattaattgctagt
agttcaacaactagcttcacaaaatttgcaactatatatctttcaccaaaagattatcat
agagtacatatgcctatagatggaaagcttacaaagatggtttatattccaggcaaactt
ttctcggttaataaaataacgaccagtaaagttgataatctctttgcaaaaaatgaacgt
ctaatctgctactttgatacaataattggagaaattgcagtaatttttgtcggtgctctt
ttagttgcaggtatagaaacagtatggcatggtaaaattgctccgaactactacaaagac
atacaaacttgggactataattctgctaaatttaatatcaaattcaataaaggcgatata
cttggatggtttaacttcggctcaacagtaattattttaacttctggaaataatgtcagt
ttcaaatttgaagagaataaaaataatattaaaatacaagtaaatcaagatttagctttg
attacagaataa

DBGET integrated database retrieval system